KEGG   Anser cygnoides domesticus (swan goose): 106045989Help
Entry
106045989         CDS       T04896                                 

Gene name
ACE
Definition
(RefSeq) angiotensin-converting enzyme
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
acyg  Anser cygnoides domesticus (swan goose)
Brite
Enzymes [BR:acyg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     106045989 (ACE)
Peptidases [BR:acyg01002]
 Metallo Peptidases
  Family M2
   106045989 (ACE)
Exosome [BR:acyg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106045989 (ACE)
CD molecules [BR:acyg04090]
 Proteins
  106045989 (ACE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 1161 aa AA seqDB search
MPFPSPQYNTILSDMDKIYSTAKVCPANDTCWELEPDLSDIMATSRSYKKLLYAWEGWHN
AAGNPLRAKYEEFVQLSNEAYRMDGFEDTGSYWRSWYDSASFEDDLEHLYNQLEPLYLNL
HAFVRRKLYDRYGPKYINLKGPIPAHLLGNMWAQQWNNIYDLMVPYPEKPNLDVTSTMVK
QGWNATHMFRVSEEFFTSLGLLEMPPEFWDKSMLEKPTDGREVVCHASAWDFYNRKDFRI
KQCTAVTMEQLFTVHHEMGHVQYYLQYKDQPVSFRSGANPGFHEAIGDVMSLSVSTPSHL
KKIGLLSSATEDAESNINYLLKMALEKIAFLPFGYLIDQWRWNVFNGHTPPSRYNYDWWY
LRTKYQGICAPISRNESNFDPGAKYHIPGNTPYIRYFVSFILQFQFHKALCQAANHTGPL
HTCDIYMSKEAGAKLREVLKAGSSKSWQEILFNLTGTDKMDAGALLEYFSPVTTWLEEQN
SKTNEVLGWPEFDWRPPVPEGYPEGIDKIADEAQAKEFLSEYNSTAEEVWNAYTEASWAY
NTNITDHNKEIMLEKNLAMSKHTLEYGMRARQFDASDFQDQTVTRILKKLSVIERAALPE
DELKEYNTLLSDMETTYSIAKVCRENKTCHPLDPDLTDILATSRDYDELLFVWKGWRDAS
GKKMKNNYKRYVELSNKAAVLNGYTDNGAYWRSLYETSTFEEDLEKLYLQLQPLYLNLHA
YVRRALYKKYGAEHINLKGPIPAHLLGNMWAQSWSNIFNLVVPYPDATEVDATPAMKEQG
WTPKMMFEESDRFFTSLGLIPMPQEFWDKSMIEKPTDGREVVCHASAWDFYNRKDFRIKQ
CTVVNMDDLITVHHEMGHVQYFLQYMDQPISFRDGANPGFHEAIGDVMALSVSTPKHLHS
IKLLDQVTENEESDINYLMSIALDKIAFLPFGYLMDQWRWKVFDGRIKEDEYNQQWWNLR
LKYQGLCPPTPRSEDDFDPGAKFHIPANVPYIRYFVSFVIQFQFHQALCTAAGHTGPLHK
CDIYQSKEAGKLLGEAMKLGFSKPWPEAMQLITGQPNMSAEALMSYFEPLMTWLVKENEK
NGEVLGWPEYNWTPYTAAQSQAGSERTDFLGMSLSSKQAAAGGWVLLALALVFVITTIFL
GVKLSSARRKAFKSSSEMELK
NT seq 3486 nt NT seq  +upstreamnt  +downstreamnt
atgccttttccctccccgcagtacaacaccatcctgagcgacatggacaaaatctactcc
acggccaaggtgtgcccggccaacgatacctgctgggagctggagccagacctctcggac
atcatggccacctcccgcagctacaagaagctcctgtacgcctgggagggctggcacaac
gccgcaggaaacccgctgcgtgccaagtacgaggagttcgtgcagctgagcaatgaggca
taccggatggacggcttcgaggacacggggagctactggcgctcctggtacgactcagcc
tccttcgaggatgacctggagcatctctacaaccagctggagccactctacctcaacctg
catgcctttgttcggaggaagctgtacgaccgctacggccccaaatacatcaacctgaag
ggccccatccctgcccacctcctgggcaacatgtgggctcagcagtggaacaacatctat
gacctgatggtcccctaccccgagaagcccaacctcgatgtgacgagcaccatggtgaag
cagggctggaatgccacccacatgttccgggtctcggaggagttcttcacctccctgggg
ttgctggagatgcccccagagttttgggacaagtccatgctggagaagccaacagatggg
cgggaggtggtgtgtcacgcctcggcctgggacttctacaaccgcaaggacttcaggatc
aagcagtgcacagcggtgaccatggagcagctgttcacggtgcaccacgagatgggccac
gtgcagtactacctgcagtacaaggaccagcctgtctccttccgcagcggggccaaccct
ggcttccacgaggccattggcgatgtcatgtccctgtctgtctccacccccagccacctc
aagaaaattgggctcctcagcagtgccaccgaggatgcggagagcaacatcaactacctg
ctgaagatggccttggagaagattgccttcctgccctttggctacctcatcgaccagtgg
cgctggaacgtgttcaacggccacacgcccccgagtcgttacaactacgactggtggtat
ctgagaactaaataccagggtatttgtgctccgatttcgaggaacgaaagcaactttgat
cctggtgcaaagtaccacatccctgggaacaccccttacatcaggtactttgtgagcttc
atcctccagttccagtttcacaaggcgctgtgccaggcggccaaccacaccggtccccta
cacacctgtgacatctacatgtccaaagaggctggagccaaactcagggaggtgctgaaa
gctgggtcttccaagtcatggcaggaaatcctgttcaacctcactggcacggataagatg
gacgctggggccctcctggagtacttcagccctgtcaccacctggcttgaggagcagaac
agcaagaccaatgaggtgctgggctggccagagttcgactggcgtccccctgtccccgaa
ggctaccccgaaggcattgacaaaatagcagacgaggcacaagctaaagagttcttgtcc
gagtacaacagcacggccgaggaggtgtggaatgcctacactgaggcgtcctgggcctac
aacaccaacatcaccgaccacaacaaagagatcatgctggagaagaacttggccatgtcc
aagcacacccttgagtacgggatgagagccaggcagttcgatgcctccgacttccaggac
caaactgtcacacgcatcctcaagaagctgagcgtcatcgagagggcagccctgcctgag
gatgagctgaaggagtacaacacccttctctcagatatggagaccacatacagcatagcc
aaggtctgcagggagaacaaaacctgtcaccccctggatcctgacctcacggacatccta
gccacctcacgggactacgacgagctcctctttgtctggaagggctggcgggatgcttct
gggaagaaaatgaagaacaactacaagcgatacgtggaactgagcaacaaggcagctgtg
ctcaacggctacacagacaatggggcttactggagatccctgtatgagacgtccaccttc
gaggaagatctggagaagttgtacctgcagcttcagcccctgtacctcaacctgcatgcc
tacgtacgccgggccctatacaaaaagtatggagctgagcacataaacctgaagggtccc
atccctgctcacctgctaggcaacatgtgggcccagtcatggtccaacattttcaacctg
gtggtgccctacccagatgccaccgaggtggatgccaccccagccatgaaagaacagggc
tggacacccaagatgatgtttgaagagtcagaccgtttctttacctccctgggcctcatc
cccatgccgcaggagttctgggacaagtccatgatcgagaagccgacggatgggcgggag
gtggtgtgtcacgcctcggcctgggacttctacaaccgcaaggacttcaggatcaagcag
tgcactgtggtgaacatggatgacctgatcacggtgcaccacgagatgggccacgtccag
tacttcctgcagtacatggaccagcccatttcattccgcgatggagccaaccctggcttc
cacgaggccattggggatgttatggccttgtctgtctccacccccaaacatctgcacagc
atcaagctgctggaccaagtcacagaaaatgaagaaagtgacattaactacctgatgagc
atcgccctggacaaaatcgccttcctgcccttcgggtacctcatggaccagtggcgctgg
aaggtgtttgatgggcggatcaaggaggacgagtacaaccagcagtggtggaacctcagg
ctgaagtaccagggcttgtgcccaccaacaccaaggtctgaagatgacttcgaccccgga
gcaaagtttcacatccctgccaatgtcccctacatcaggtactttgtcagcttcgtgatc
cagttccagttccaccaagctctctgcactgcagccgggcacacggggcctcttcacaag
tgtgacatctaccagtccaaggaggccgggaagctcttgggggaggccatgaagctgggt
ttcagcaagccgtggcctgaagccatgcagctcatcacagggcagcccaacatgtcagcc
gaggccctgatgagctacttcgagcccctcatgacgtggctggtgaaggagaacgagaag
aacggggaggtcctgggctggcccgagtacaactggactccttacacagctgctcaaagc
caagctggctccgagcgaaccgatttcctgggcatgtccctgagcagcaaacaagccgcc
gcaggtggctgggtcctgctcgccctggcgctcgtcttcgtgatcaccaccatcttcttg
ggcgtcaagttgtcctcggcaaggagaaaggccttcaaatccagctcagaaatggaactg
aaataa

DBGET integrated database retrieval system