KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_0962Help
Entry
Adeh_0962         CDS       T00326                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ade00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    Adeh_0962
Enzymes [BR:ade01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Adeh_0962
DNA repair and recombination proteins [BR:ade03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Adeh_0962
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1108669..1109610)
Genome map
AA seq 313 aa AA seqDB search
MARAQQGVEVEVEGRRILLRNLDKVFYPEAGFTKGEVVDYYRRVAPVLLPHLRDRPLTLK
RYPEGVEGPHFYEKRCPRHRPDWFRTEAIWSEGNQEYIDYCVVDDLSSLVWLASIADLEL
HPSLSLVDDVERPTALVFDLDPGPPADLLACCEVALLLRRLLAALGLEAFPKSSGSKGMQ
LYVPLSGATYADTKPFAHAVARLLERRHPQLVVERMAKALRGGKVLVDWSQNDPHKTTVC
VYSLRARPRPTVSTPLRWAEVEKAARTRDAGGLVFEAAAVLRRVERVGDLFAPVLTLRQR
LPAPAELERAAGA
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcgcgcagcagggcgtggaggtcgaggtggaggggcggcggatcctcctccgc
aacctcgacaaggtgttctaccccgaggccggcttcaccaagggcgaggtggtggactac
taccgccgcgtcgcccccgtgctcctgccgcacctgcgcgaccggccgctcacgctgaag
cgctacccggagggcgtggagggcccgcacttctacgagaagcgctgcccgcgccaccgc
ccggactggttccggaccgaggcgatctggagcgagggcaaccaggagtacatcgactac
tgcgtggtggacgacctgtcctcgctggtgtggctcgccagcatcgccgacctcgagctc
cacccctcgctgtcgctggtggacgacgtggagcgccccaccgcgctcgtgttcgacctc
gaccctggcccgcccgcggacctgctcgcgtgctgcgaggtggcgctgctgctgcgccgg
ctgctcgccgcgctcggcctggaggcgttcccgaagagctccggctcgaagggcatgcag
ctgtacgtgccgctctccggcgcgacgtacgccgacacgaagccgttcgcgcacgcggtc
gcccgcctgctcgagcggcggcacccgcagctcgtggtggagcggatggcgaaggcgctc
cgcggcgggaaggtgctggtggactggagccagaacgacccgcacaagaccacggtctgc
gtctactcgctccgggcgcggccgcggcccaccgtctcgaccccgctgcgctgggcggag
gtggagaaggcggcccggacgcgcgacgcgggcgggctggtgttcgaggccgcggcggtg
ctccgccgggtcgagcgcgtcggcgacctgttcgccccggtgctgacgctgcgccagcgc
ctgcccgctcccgcggagctcgagcgggcggccggcgcctga

DBGET integrated database retrieval system