KEGG   Anaeromyxobacter dehalogenans 2CP-C: Adeh_2024Help
Entry
Adeh_2024         CDS       T00326                                 

Definition
(GenBank) peptidyl-dipeptidase A
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
ade  Anaeromyxobacter dehalogenans 2CP-C
Brite
Enzymes [BR:ade01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     Adeh_2024
Peptidases [BR:ade01002]
 Metallo Peptidases
  Family M2
   Adeh_2024
Exosome [BR:ade04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Adeh_2024
CD molecules [BR:ade04090]
 Proteins
  Adeh_2024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2265375..2267219)
Genome map
AA seq 614 aa AA seqDB search
MTTLPVLQLAAVLLAAAPSAPAAPPQAAAAAKPTAADAKAFVGEANAELKKLWIRWSTAE
WIKSTYITDDTERNAAALNEDQMAYLTDAIRGAVRFQGVGADPDTERMLMLLRIASPLPA
PSDAAQRAELAQLAAKLEGMYGKGKWCGAPGSAARGAEKCRDLQDLEQVMAKSRDYDALL
DAWTGWHTISRDMRPLYERMVTISNAGAREIGFRDLGDLWRSGYDMPPDAFEADTDRLWA
QVKPFYEELHCYVRSKLQRAYGKARVPDGKPIPAHLLGNMWAQDWANLYPLVEPYHGQPS
LDVDAALRRQKTDPIKMVKLGEAFFTSLGFEPLPKTFWERSQFTKPRDRDVVCHASAWDV
TYSADLRIKMCIRPTEEDLVTIHHELGHNFYQRAYVHLPVLFQNGANDGFHEAIGDAIAL
SITPGYLKQVGLIQTVPKDEKGVVNVQMKRALEKVAFLPFGKLIDQWRWDVFSGKTPPSR
YNAAWWELRRKYQGVDAPVSRSEADFDPGAKYHVPANVPYTRYFLAHVYQFQFHKALCEA
AGWKGPLHECSIYGSKAAGKKLEAMLAMGASKPWPDAYEALTGSRQADASAMLEYFAPLR
AWLRKQTAGQSCGW
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgacgacactcccggtcttgcagctcgcagccgtcctcctcgccgccgcgccctccgcg
ccggcggcccccccgcaggccgcagccgccgcgaagcccaccgccgccgacgcgaaggcg
ttcgtgggcgaggccaacgcggagctcaagaagctctggatccgctggtccaccgcggag
tggatcaagtccacgtacatcaccgacgacaccgagcggaacgccgcggccctcaacgag
gaccagatggcgtacctgaccgacgccatccgcggcgcggtccggttccagggcgtcggc
gccgacccggacaccgagcgcatgctgatgctgctgcgcatcgcctcgccgctgccggcg
ccgagcgacgccgcgcagcgcgccgagctggcgcagctggcggcgaagctcgagggcatg
tacggcaagggcaagtggtgcggcgcgcccggcagcgcggcgcgcggggcagagaagtgc
cgcgacctgcaggacctcgagcaggtgatggcgaagagccgcgactacgacgcgctgctc
gacgcctggaccggctggcacaccatctcgcgcgacatgcgtccgctctacgagcggatg
gtgacgatctccaacgcgggcgcgcgcgagatcggcttccgcgatctcggcgacctgtgg
cgcagcggctacgacatgccgccggacgcgttcgaggccgacaccgaccggctctgggcg
caggtgaagccgttctacgaggagctgcactgctacgtccgcagcaagctgcagcgggcg
tacggcaaggcgcgggtgccggacggcaagcccatcccggcgcacctgctcggcaacatg
tgggcgcaggactgggccaacctctacccgctggtcgagccgtaccacgggcagccgtcg
ctcgacgtggacgcggcgctgcgccggcagaagacggacccgatcaagatggtgaagctg
ggcgaggcgttcttcacctcgctgggcttcgagccgctcccgaagacgttctgggagcgc
tcgcagttcacgaagccgcgcgaccgcgacgtggtgtgccacgccagcgcctgggacgtg
acctactccgccgacctgcgcatcaagatgtgcatccggccgaccgaggaggacctcgtc
accatccaccacgagctggggcacaacttctaccagcgcgcctacgtgcacctgccggtg
ctgttccagaacggcgcgaacgacggcttccacgaggccatcggcgacgccatcgcgctg
tccatcacccccggctacctgaagcaggtcggcctgatccagaccgtgccgaaggacgag
aagggcgtggtgaacgtgcagatgaagcgggcgctcgagaaggtcgcgttcctgccgttc
ggcaagctcatcgaccagtggcgctgggacgtgttctccggcaagacgccgccgtcgcgc
tacaacgccgcctggtgggagctgcgccgcaagtaccagggcgtggacgcgccggtctcg
cgcagcgaggcggacttcgacccgggcgcgaagtaccacgtgcccgcgaacgtgccctac
acgcgctacttcctcgcgcacgtgtaccagttccagttccacaaggcgctgtgcgaggcc
gccggctggaagggcccgctgcacgagtgctcgatctacggctcgaaggcggccggcaag
aagctcgaggccatgctggccatgggcgcgtcgaagccgtggccggacgcgtacgaggcg
ctgaccggctcgcgccaggcggacgcgtcggcgatgctcgagtacttcgcgccgctgcgc
gcctggctgcgcaagcagaccgccggccagtcctgcggctggtag

DBGET integrated database retrieval system