KEGG   Acropora digitifera (stony coral): 107334404Help
Entry
107334404         CDS       T04352                                 

Definition
(RefSeq) histone-lysine N-methyltransferase NSD2-like
  KO
K11424  histone-lysine N-methyltransferase NSD2 [EC:2.1.1.43]
Organism
adf  Acropora digitifera (stony coral)
Pathway
adf00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:adf00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    107334404
Enzymes [BR:adf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107334404
Chromosome and associated proteins [BR:adf03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107334404
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PWWP SET PHD zf-HC5HC2H zf-HC5HC2H_2
Motif
Other DBs
NCBI-GeneID: 107334404
NCBI-ProteinID: XP_015754820
LinkDB All DBs
Position
Un
AA seq 1218 aa AA seqDB search
MAAVESKDDSASSELSESLHAKDSKVSSSPNQTASWLVGDVVWSKIPGHPWWPSMVSYDP
NTAVSFKYKGRARFYHVQFFGQDPVRGWVAERSILKFEGRQNFENSLHGKQLKIAQKRIS
LWESAVSVAEKAKPMNRHERQLCYTFKYYDKNETKKIDPFKVKKLNGFSSVPGSATLAEH
VNGVDSSHQERTCDSNNSETPVSEPVAITGAESYSDSLKCAQKKTVKEKLPRKRKLGSSS
GTAKSPRDLVESSKNVEPPKKKKKRTLKGSKELNLSESDLVGNDTKEAMKANLSDKHFSE
IDKKCNGLYNTPDATPPRINGDVSSFIDAMEVSPNTALKLKIRKITPKQNQAEGKRKRGR
PRKPRFVIVSEDGNENEGASQQVLPMDVESNEISNVQAKSTLFTETNAEDIPKKKKRIPK
PTKKMLNAKESALLPSKDMPILKGKKKLAPKSECVAKTKEKIEVSNAKLKSPKGKVPSKS
EKVKNVEDKKSEVSTAETSVPAVETEGSVTSSTDDTGSIKNGTVSKREKDGVCIVCEQQE
NLIFCEGICGNSFHLDCIGLSVVPKGKFVCDECVTGNHCCFVCRQAGNVKQCSQPMCTKY
YHDECVKTYKTAKFDGDRFFCPLHFCTTCVSNKSVVSRGRLIRCVRCPTAYHISGCLVAG
CIPICSNLMVCSKHFIRDKNKAHHTHVNVNWCFVCSIGGTLICCESCPAAFHPECISYEG
IPEGHFFCKDCAEGKHLLYGDIVWVKLGMYRWWPAQICNPRDVPTNIQNMRHQPGEFPVQ
FLGSHDYYWIHRGRVFSYQEGDKGSSDSGNNKNLAKVFKKALAEAKEKYAEWRTLQESKA
EQDLQKMSKKPAPYKQIKVNKCTTAVRIVIDPSELPMCDCSASNESPCGPESNCLNRMLQ
FECYPQRCPGKENCQNQRFQKRQYVDCEPFRTLHRGWGLRCKEDVKKGQFVIEYVGELID
DATCQERVQKGEDITNYYMLTIDKDCIIDAGPMGNLSRFMNHSCDPNCETQKWTVNGEVR
VGLFASREIMAGEELTFDYQLDCLGNEKKKCHCGAKNCSSFLGVRPKNQVQEDKAKKTGD
KRKKKRIKKTVVKEVHEDECYICGDGGELLMCDKGGCKKCYHKTCLGSDVNTRGKWICPW
HFCDDCGKWANIMCSECPNSYCRSHASGQITELANGVHLCCDHIVTRNSPVPNQAFEEEK
VDHSKPNADVELSDVGLE
NT seq 3657 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagtggaatctaaagatgatagtgcatcctctgagctgtcagagagtctgcat
gccaaagattcgaaagtttcttcaagtccgaatcaaactgcttcgtggctcgtcggagat
gtagtgtggtcgaaaatcccaggccatccatggtggccttcgatggtttcttacgatcct
aacaccgctgtttcgttcaagtacaaggggagagcaagattttatcatgtgcaatttttc
ggtcaggatcctgtgagaggctgggtcgctgaaaggtcgatcttaaaattcgaagggcga
caaaactttgagaattcacttcatggaaaacaattgaagattgctcaaaaacgtatttcc
ctttgggaatcagctgtcagtgtggctgagaaagcaaagccaatgaacagacatgaacgg
caactgtgttacaccttcaagtactatgataagaacgaaacaaaaaagattgatcctttc
aaagtcaaaaagttaaatggttttagctcagtgcctggctctgccactttggcagagcat
gtaaatggtgtcgatagtagccatcaggaaaggacatgtgattccaacaattctgaaaca
ccggtgtcagaaccagtagccatcacaggagctgagagttacagtgatagcttgaagtgt
gcacagaagaaaactgtgaaagaaaaactcccacggaaacgaaaactgggttcttcgtca
gggactgcaaagtctcccagagaccttgttgaatcatccaaaaatgttgaacctccaaag
aaaaagaaaaaaaggactttgaaaggaagcaaagaattgaacttgtcagagtctgatttg
gttggcaacgacactaaggaggcaatgaaagcaaacttgagcgacaaacacttttcagaa
atagataaaaaatgtaatggtttgtacaatacgcctgatgctactcctccaagaataaac
ggcgatgtatcttcttttattgatgcaatggaagtgtcacccaacactgcattgaagttg
aaaatccgcaagattacaccaaagcaaaaccaagctgaaggcaaacgtaagaggggaagg
ccaagaaaaccacgatttgtgatagttagtgaagatggtaatgaaaatgaaggtgcaagt
caacaggttttgccaatggatgtggagagcaatgaaatttctaatgttcaggcaaaatca
actctattcacagaaaccaatgcagaagacatcccaaagaagaaaaaacgcattccaaag
ccaactaaaaagatgttaaatgccaaggaatcagccttgttgccaagtaaggacatgcct
atcttaaaagggaaaaagaaactagcgccaaaaagtgaatgtgtggcaaagacaaaagag
aagattgaagtaagcaatgcaaagttaaaatctccaaaagggaaagttccatcaaaaagt
gaaaaggttaaaaatgtggaggataagaaaagtgaagtttctactgcagaaacaagtgtt
cctgccgttgaaactgagggtagtgtcacatcatcaacggacgatactggaagtattaag
aatggcacagtttctaaaagggaaaaggatggagtttgtattgtgtgcgaacaacaggaa
aatctaatattttgtgaggggatttgtggaaattccttccatttggactgtattgggctt
tcagtggttccaaagggcaaatttgtatgtgacgagtgtgtgactggcaatcattgctgc
tttgtttgcagacaagcgggaaatgtcaaacagtgtagtcaaccaatgtgtacaaagtat
tatcatgacgagtgtgttaaaacatacaaaactgccaagtttgatggcgatcgctttttc
tgtcctcttcatttctgtactacgtgtgtttcaaacaaatctgttgtgtctagaggacgc
ttgattcgttgtgtacgttgtccaactgcgtatcacatctctggctgccttgtggcaggt
tgtattccaatctgttccaatctaatggtctgctcaaagcactttatacgggataaaaat
aaggctcatcatacacatgtgaatgtaaactggtgtttcgtttgttcaatcggaggcaca
ttgatttgttgtgaaagctgcccagcagcatttcaccctgaatgcatcagttatgagggc
attccagaggggcatttcttttgcaaggattgtgcggaaggaaaacatcttttgtatgga
gacattgtgtgggtaaagcttggaatgtacaggtggtggccagcacagatatgcaatccc
cgtgatgtgcccaccaatatccagaacatgcgacaccagcctggagagtttcctgtgcag
tttcttggttcacatgattattactggattcacagaggtcgggttttcagctatcaggag
ggggataagggatcttctgattctggcaacaacaaaaatctggcaaaagtattcaaaaaa
gctcttgctgaggcaaaagaaaagtatgcagaatggaggacgctgcaagaaagcaaagca
gagcaagatcttcagaagatgtccaagaaaccagctccatacaaacagataaaggtaaac
aaatgcacaacagccgtccgcattgtgatcgatccttcagaacttcctatgtgcgattgc
tcggctagcaatgaaagcccctgtggtccggaatcaaattgtttgaaccgtatgttacag
tttgaatgctatcctcaaagatgtcctggaaaggaaaactgccagaatcaacggtttcaa
aagaggcaatatgtggattgcgaacctttccgaacattgcaccgtggatggggattgagg
tgcaaagaggatgtgaagaagggtcagtttgtcattgaatatgttggagagcttattgac
gatgctacatgtcaagagcgtgtgcagaaaggagaggacatcaccaactactatatgttg
acaatagacaaggattgcataattgatgcaggcccaatgggaaatctgtcacgatttatg
aatcatagttgtgatccaaactgtgagacacagaaatggacagttaatggagaagttagg
gtgggactgtttgcttcaagagaaataatggcaggagaggaacttacgtttgattatcag
cttgactgtttaggcaatgaaaagaagaagtgtcattgtggagccaaaaactgcagcagt
tttcttggagtgaggccaaagaaccaggttcaggaggataaagcaaagaaaacaggagac
aaaagaaagaagaaaagaatcaagaaaactgtggtgaaagaagttcacgaggatgaatgt
tacatctgtggtgatggcggcgagcttcttatgtgcgacaagggaggctgtaaaaagtgc
tatcataaaacctgtttaggcagtgacgtcaacacacgaggcaagtggatatgtccttgg
catttctgcgatgattgtggcaagtgggcaaacatcatgtgttcagaatgtccaaactca
tattgcagaagccacgcatcaggtcaaattacggaattagccaatggggttcatttgtgc
tgtgaccatattgtaacaaggaacagtcctgtgccaaaccaggcttttgaggaagagaag
gtggaccacagcaaacccaatgctgatgttgaattgtcagatgtgggtttggaatag

DBGET integrated database retrieval system