KEGG   Alicycliphilus denitrificans K601: Alide2_0354Help
Entry
Alide2_0354       CDS       T01463                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
adk  Alicycliphilus denitrificans K601
Brite
Translation factors [BR:adk03012]
 Eukaryotic Type
  Elongation factors
   Alide2_0354
 Prokaryotic Type
   Alide2_0354
Mitochondrial biogenesis [BR:adk03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Alide2_0354
Exosome [BR:adk04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Alide2_0354
  Exosomal proteins of breast cancer cells
   Alide2_0354
  Exosomal proteins of colorectal cancer cells
   Alide2_0354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-ProteinID: AEB82781
UniProt: F4GFZ7
LinkDB All DBs
Position
381731..382921
Genome map
AA seq 396 aa AA seqDB search
MAKGKFERTKPHVNVGTIGHVDHGKTTLTAAIATVLAKKFGGEAKGYDQIDNAPEEKARG
ITINTSHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLDKYEFPGDDTPIIRGSAKLALE
GDQSDKGEPAILKLAEALDTYIPTPERAVDGTFLMPVEDVFSISGRGTVVTGRVERGIIK
VGEEIEIVGIRETQKTTVTGVEMFRKLLDQGQAGDNVGLLLRGTKREDVERGQVLCKPGS
IKPHTHFTAEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDVTGSIELPADKEMVMPGDNVS
ITVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaggtaaattcgaacggaccaagccccacgtgaacgtgggcacgatcggtcac
gtggaccatggcaagacgacgctgacggcggcgattgcgacggtgctggccaagaagttc
ggcggcgaagccaagggctacgaccagatcgacaacgcgcccgaagaaaaggcccgcggc
atcaccatcaacacctcgcacgtggaatacgaaacggccaaccgccactacgcccacgtg
gactgccccggccacgccgactacgtcaagaacatgatcacgggcgccgcccagatggac
ggcgccatcctggtgtgctcggccgccgacggcccgatgccccagacgcgtgaacacatc
ctgctggcgcgccaggtgggcgtgccctacatcatcgtgttcctgaacaagtgcgacatg
gtggacgacgaagaactgctcgaactcgtcgaaatggaagtgcgcgaactgctggacaaa
tacgaattccccggcgacgacacccccatcatccgcggctcggccaagctggccctcgaa
ggcgaccaatcggacaagggcgaacccgccatcctcaagctcgccgaagcccttgacacc
tacatccccacgcccgagcgcgcggtggacggcaccttcctcatgcccgtggaagacgtg
ttctccatctccggccgcggcaccgtggtgaccggccgcgtcgagcgcggcatcatcaag
gtcggcgaagaaatcgaaatcgtcggcatccgcgaaacgcaaaagaccaccgtcaccggc
gtggaaatgttccgcaagctgctggaccagggccaggctggcgacaacgtgggcctgctg
ctgcgcggcaccaagcgcgaagatgtcgagcgcggccaggtactgtgcaagcccggctcc
atcaagccgcacacgcacttcaccgccgaagtgtacgtgctgagcaaggacgaaggcggc
cgccacacgcccttcttcaacaactaccgtccgcagttctacttccgcacgaccgacgtg
acgggctccatcgaactgccggccgacaaggaaatggtcatgcccggcgacaacgtgtcg
atcaccgtcaagctgatcgcgccgatcgccatggaagaaggcctgcgctttgccatccgc
gaaggcggccgcaccgtgggcgcgggcgttgtggcaaagatcatcgagtaa

DBGET integrated database retrieval system