KEGG   Auricularia subglabra: AURDEDRAFT_53682Help
Entry
AURDEDRAFT_53682  CDS       T03129                                 

Definition
(RefSeq) putative alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
adl  Auricularia subglabra
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:adl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AURDEDRAFT_53682
Enzymes [BR:adl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AURDEDRAFT_53682
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
LinkDB All DBs
Position
Unknown
AA seq 502 aa AA seqDB search
MAHHANEQYSAKPQNYTMFQAFEWYCEGDGVHWTKLEKRLGELNDIGISAMWIPPPTKAA
GPNSVGYDIYDLWDLGEFDQKGAVTTKYGTKDQLERLIKKAHELGINTYVDAVLNHRFGA
DKTEKFGATEVDPNDREKEVSDKYDIKGWTGFTFEGRNGKYSKFKYNFNHFTGVDYNQDG
ERTAIYKIHGDGKDWAQGVDDENANYDYLMGADIDHSHPDVVEDTVAWGKWIVDSFPGRR
FDAVKHIDSKFIAEFVDRVRKETQIDSLFAVGEFWKDSLESLEKYLDSLGTQFSVFDTPL
HYNFKEAADTGSGYDLRTIFDGTVVQARPIDAVTLVDNHDTQKGQSLESWISPQFKPLAY
ALILTRPAGYPCVFWGDLYGCAGKDPQEPMKQLGDFVRARKLFAYGEMRDYWDHPNCLGW
VRVGDEDHDGCAVVICNGNEPGTKRMEIGKEHAGEKWTDTLGWSQGEITIGEDGWAEFRC
PAMSTSIWTKVDARGRDEFKRA
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggcacaccacgccaacgagcagtattcggcgaagccgcagaactacacgatgtttcag
gcgttcgaatggtattgcgagggcgacggcgtgcattggaccaagctcgagaagcgcctt
ggcgagctcaatgatattggtatctcagcaatgtggattccgcctcccaccaaggcggcc
gggcccaacagcgtcggctacgacatctacgacctgtgggacctgggcgagttcgaccag
aaaggcgctgttaccacgaaatacggcaccaaggaccagcttgaacggctgatcaagaag
gcgcacgaacttggaattaacacctacgtcgacgcggtgctcaaccatcgcttcggagcc
gacaagactgagaagttcggcgcgaccgaagtcgatcccaatgaccgcgagaaggaagtc
agcgacaagtacgatatcaagggctggacggggttcacgttcgaggggcgcaacggcaaa
tatagtaaattcaagtacaatttcaaccacttcacgggtgtggactacaaccaagacggc
gagaggacggccatatacaagatccacggcgacggcaaggactgggcacaaggcgtagac
gatgagaacgcaaactacgactatctgatgggcgcggacatcgaccacagccatcctgat
gtggtcgaggacaccgtggcctgggggaagtggatagtcgacagcttccctggtcgcagg
ttcgacgcggtgaagcacatagacagcaagttcatcgcggagttcgtcgaccgcgtgcgc
aaggagacgcagatagacagcctgttcgccgtgggcgagttctggaaggactcgctcgag
tcgctcgagaaatacctcgactcgctgggcacccagttcagtgtgtttgatacgccactg
cattacaatttcaaggaggcggccgacacggggagcgggtacgacctgcgcacgattttc
gatgggacggtcgtccaggctagacctatcgacgccgtcacgctcgtcgataaccacgac
acgcaaaagggccagtccttggagtcctggatctccccgcaattcaagccgctggcctat
gcgctgatcctcacgcgccccgccggctacccgtgcgtcttctggggcgatctctacggc
tgcgccggcaaagacccgcaggaacccatgaagcaactcggcgactttgtccgtgcgcgc
aagctgtttgcgtacggcgagatgcgcgactactgggaccatccgaattgtctgggatgg
gtacgggtcggggacgaggaccacgacggctgcgctgtagttatttgtaacggcaacgag
ccgggcacgaagcgcatggagattggcaaggagcatgctggggagaaatggacggacacc
ctcggctggtctcaaggcgagatcacgatcggcgaggatggctgggctgagttcagatgc
ccggcgatgagtaccagcatctggaccaaggtcgatgcacgcggccgcgatgagttcaag
cgcgcgtag

DBGET integrated database retrieval system