KEGG   Auricularia subglabra: AURDEDRAFT_92025Help
Entry
AURDEDRAFT_92025  CDS       T03129                                 

Definition
(RefSeq) glycogen synthase
  KO
K00693  
glycogen synthase [EC:2.4.1.11]
Organism
adl  Auricularia subglabra
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:adl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AURDEDRAFT_92025
Enzymes [BR:adl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     AURDEDRAFT_92025
Glycosyltransferases [BR:adl01003]
 Polysaccharide
  Storage polysaccharide
   AURDEDRAFT_92025
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
LinkDB All DBs
Position
Unknown
AA seq 740 aa AA seqDB search
MADASEVKRDVRNPLLFECAWEVANKVGGIYTVIKTKVPVTVSEYGDRYCLIGPLSYKTA
PMEVEPMEPTGDPALADTLQSMKDRGVKLLYGRWLVEGAPRVLLFDTGSQYSRLDEWKGD
LWNLAGIPTPPHDHETNETIVFGYLVAWFLGEYVSRNLTKAVIAHFHEWQAGVAIPLCRK
RHMDVTTVFTTHATLLGRYLCAGSVDFYNNLQYFDVDHEAGKRGIYHRYCIERAATHCAD
VFTTVSHITAFESEHLLKRKPDGVLPNGLNVVKFSAMHEFQNLHAISKSKINDFVRGHFY
GHYDFDLENTIYMFTAGRYEYRNKGVDMFIESLARLNYRLKSSGSNVTVVAFIIMPAATH
SYTVEALKGQAVTKQLRDTVTEIQNRIGQRIFEKAARFPGEGSNDIPAFNDLLSEEDRVL
LKRRIFALKRNSLPPVTTHNMADDSTDPILNQIRRVQLFNNSSDRVKVVFHPDFLNSNNP
ILGLDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSITTNLSGFGSFMQDLIESPHE
EGCYIVDRRMQSLEDSVSQLTEYMLSFCNKTRRQRINQRNRVERLSPLLDWKNLGIEYSK
ARQLALRRAYPDQYASDFGEQEDADYGFPGSERPAFSVPGSPRFRTGAMTPGDIGTLTEE
MQSLETSDYRGNQIWSRIDEDEGYPFPLILKVRSRASSIRSGASTPGGMNRTLSEGDLKK
ADAALSSIKQANINGMPNGK
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgcgtctgaggtcaagcgcgacgtccgcaacccgctgctgttcgaatgcgcc
tgggaggtcgccaacaaggtgggcggcatctacaccgtcatcaaaacgaaggtccccgtg
accgtcagcgagtacggcgaccggtattgtctcattgggccgctgtcgtacaagacggcg
cccatggaggtcgagcccatggagcccacgggtgacccggcgctcgcagacacgctgcag
tcgatgaaggaccgcggcgtcaagctgctgtacggccgctggctcgtcgagggcgcgccg
cgcgtgctgctgttcgacacgggctcgcagtacagccggctcgacgagtggaagggcgac
ctctggaacctcgctggcatccccacgccgccgcacgaccacgagacgaacgagaccatc
gtctttggctatctcgtcgcctggttcctgggcgagtacgtctcgcgcaacctcaccaag
gccgttatcgcccacttccacgaatggcaggccggcgtcgccatccccctgtgcagaaag
cggcacatggacgtcaccaccgtcttcaccacccacgcaacgctcctcggccgctacctc
tgtgccggctcggtggacttttacaacaacctccagtacttcgacgtggatcacgaggcg
ggaaagcgcggcatttaccacagatactgtatcgagcgtgccgcgacacactgcgcagac
gtcttcaccaccgtctcccacatcaccgccttcgagtccgagcacctcctcaagcgcaag
ccagacggcgtgcttcccaacggcctcaatgtcgtcaaattctccgccatgcacgagttt
cagaacctgcatgctatctccaaatccaagattaacgactttgtccgcggccacttctac
ggccactacgacttcgatctcgaaaacaccatttacatgttcacggctgggcgatacgag
taccgcaacaagggcgtggacatgttcatcgagtcgctcgcacggctcaactaccggctc
aagtcctcaggctccaacgtcaccgtcgtcgcgttcatcatcatgccggccgcgacgcac
tcatacaccgtggaagctctcaaggggcaggctgtcaccaagcaacttcgcgacaccgtc
accgagattcaaaatcgcatcggccaacgcatcttcgagaaggctgcgcgcttcccaggt
gagggcagcaacgacatcccggcgttcaacgacctgctttccgaggaggaccgcgtgttg
ctcaagcgacgcatattcgcgctcaagcgcaattcgctgccgcccgtcacgacgcataac
atggcggacgactccacggacccaatcctgaaccagatccggcgcgtgcagctgttcaac
aattcgtcagaccgtgtcaaggtcgtcttccaccccgacttcctcaactcgaacaacccc
atcctcggcctcgactatgaggagttcgtccgtggctgccatcttggcgtcttcccgtcc
tactacgagccgtggggctacacgccggcggagtgcaccgttatgggcatcccaagcatt
acgacgaacttgagtgggttcggtagcttcatgcaggacctgatcgagagccctcacgag
gagggctgttacatcgtcgaccggcggatgcagagcctggaggattcggtcagccagctg
acagagtacatgctctcgttctgcaacaagacgcggcgccagcgcatcaaccagcgcaac
cgtgtcgagcgtttgagcccgctgctcgactggaagaacctcgggatcgaatactccaag
gcgcgccagcttgcgctgcgccgtgcgtacccggaccaatacgcgagcgacttcggcgag
caggaggatgcggattacggcttccctggcagcgagcgccccgcgttctccgtgcctggc
agcccgcgcttcagaaccggcgcgatgacgcctggagacatcggcacactcaccgaggag
atgcagagcctcgagacgagcgattaccgcggaaaccagatatggagtaggatcgatgag
gacgaggggtatcctttcccgctcatcctgaaggttcgctcgcgcgcgagctcgatccgg
tccggcgccagcacgcctggtggcatgaaccggacgctgagcgagggcgacctcaagaag
gcggatgccgcgctcagcagcatcaagcaggccaatatcaacggcatgcccaacggcaag
tag

DBGET integrated database retrieval system