KEGG   Alicycliphilus denitrificans BC: Alide_0290Help
Entry
Alide_0290        CDS       T01397                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
adn  Alicycliphilus denitrificans BC
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:adn00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Alide_0290
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Alide_0290
Enzymes [BR:adn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Alide_0290
Peptidoglycan biosynthesis and degradation proteins [BR:adn01011]
 Precursor biosynthesis
  Racemase
   Alide_0290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
323210..324304
Genome map
AA seq 364 aa AA seqDB search
MPRPILATIHPAAVQHNLERARRAAPDARMWAVVKANAYGHGIERVFEGLRSADGIALLD
MAEAERVRRLGWRGPVLLLEGVFEPRDLELCSRLSLWHAVHCDEQIDWLAAHKTQAPHRV
FLKMNSGMNRLGFAPGRYRSAWARLNALPQVDEISFMTHFSDADGPRGIAHQVQAFHRAT
QDLPGERCIANSAAILRHGGEAQVRLDWVRAGIALYGSAPDHPERTAVDWGLEPAMTLAS
RIIGVQQLQAGDTVGYGSRFTAEGPLAIGVVACGYADGYPRHCDTGTPVLVNGVRTRTIG
RVSMDMIAVDLTPVPGAGMGAEVTLWGRAANGVVLPIDEVAEAGGTVGYELMCALAPRVP
VSVD
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgccccatccttgccaccatccaccccgcagccgtgcagcacaacctcgagcgt
gcgcgccgcgccgcgcccgatgcgcgcatgtgggccgtggtcaaagccaacgcctacggc
cacggcatagagcgcgtgttcgagggcctgcgctcggccgacggcatcgcgctgctggac
atggcagaggccgagcgcgtgcgccggctcggctggcgcggccccgtcctgctgctggag
ggcgtgttcgagccgcgcgacctggagctgtgctcgcgcctgtcgctgtggcacgccgtg
cactgcgacgagcagatcgactggctggccgcgcacaagacccaggcgccgcaccgcgtg
ttcctcaagatgaactccggcatgaaccgcctgggcttcgcgcccgggcgctaccgctcg
gcctgggcgcgcctgaacgcgctgccgcaggtggacgagatctccttcatgacgcatttc
tccgatgccgacgggccgcgcggcatcgcccaccaggtgcaggccttccatcgcgccacg
caggacctgccgggcgagcgctgcatcgccaacagcgccgccatcctgcgccatggtggc
gaggcccaggtgcgcctggactgggtgcgcgccggcatcgcgctgtacggcagcgcgccc
gaccatcccgagcgcaccgccgtcgactggggcctggagccggccatgacgctggcctcg
cgcatcatcggcgtgcagcagctgcaggcgggcgacaccgtgggctatggctcgcgcttc
acggccgaggggccgctcgccatcggcgtcgtggcctgcggctacgccgacggctacccg
cgccactgcgacaccggcacgcccgtgctggtcaatggcgtgcgcacgcgcaccatcggc
cgcgtgagcatggacatgatcgccgtggacctcacgcccgtgcccggcgccggcatgggc
gccgaggtcactctctggggccgcgccgccaacggcgtcgtgctgcccatcgacgaggtg
gccgaggccggtggcaccgtgggctacgagctcatgtgtgcgctcgcgccgcgcgttccc
gtttccgtagactga

DBGET integrated database retrieval system