KEGG   Acromyrmex echinatior (Panamanian leafcutter ant): 105143175Help
Entry
105143175         CDS       T03917                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn], chloroplastic-like isoform X1
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
aec  Acromyrmex echinatior (Panamanian leafcutter ant)
Pathway
Peroxisome
Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:aec00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    105143175
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    105143175
Enzymes [BR:aec01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     105143175
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 179 aa AA seqDB search
MMNRMVALLVAAVIAVTATHAEEELVAVVRLISFSSRNVTGNLKIVQTPLDGPVTITGKI
FGLTEGPHGFHVHEKGDLSEGCKSAGAHFNPENNTHGAPEDTVRHVGDLGNIMANTAGEA
IINITDNIISLRGSNSIVGRSIVVHSDEDDLGKGNHSLSLTTGNSGDRWACGVVGIEKI
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatcgaatggttgcgttactagtggcagctgtaattgctgttacagctacacat
gcggaagaggaattggtggcggtcgtccgtctaatatcattttcctcaagaaatgtcacg
ggtaacttgaagattgttcaaactcccctggatggacccgttactattaccggcaagatc
ttcggactcacagaaggaccacacggttttcatgtgcatgaaaagggagatttgagtgag
ggttgcaaatccgcgggagcgcactttaaccctgagaacaacactcacggtgccccggaa
gatactgtcagacatgtcggcgatctaggaaatatcatggccaatactgcgggagaagcg
ataataaatatcactgacaatatcatctcgctgagaggatcgaatagcatcgtggggcgg
tccatagttgtacattccgacgaggacgatcttggcaagggcaatcattctctttctttg
acaaccggaaattctggcgatcgctgggcctgcggtgtcgttggcatcgaaaaaatctga

DBGET integrated database retrieval system