KEGG   Acromyrmex echinatior (Panamanian leafcutter ant): 105144993Help
Entry
105144993         CDS       T03917                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SETDB1 isoform X1
  KO
K11421  
histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
aec  Acromyrmex echinatior (Panamanian leafcutter ant)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:aec00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    105144993
Enzymes [BR:aec01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     105144993
Chromosome [BR:aec03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     105144993
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    105144993
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 1149 aa AA seqDB search
MSLISLKSEELFSKTIIRKMAQAQSAEIIELMSDEDEKKTRKTKSKGYNSNCVNFKCRSG
INMKVAPSFACAFYGVSLEKKKKRIICKECFDAALQHQKQLVQAFVENRSLLDCYFPDHT
MEVEISDSDDSDDEKKKELEKDNNEYIPEDVLLDIKDKLNDTLSHIYKKYNVEQHAKVAC
ETLKQRWRDICAANDSLNTEIREIMRTVDKLRNNLYEDFRPQIKMLEELQINDEITETAH
PLVATKKVTQVRVPPSSLLQDNQLEVLAIEPSCTKEIIIPNLPPTGPLLKRSPEIDDIVY
VMKSPVMPWIKAKVLNIVSNPWNIRVRLIQKKYNAAIKTVSGKLLATTELSKVMIPVGTR
VVAIFHDVVSNNYYSGIIAETPKSINKYRYLVFFDDGYAQYVVHNDILLVWETSPRIWED
IPSESREFVKKYLESYPERPMVKLQPGQIVKTEWNGKWWLARVVQVDASLVQMHFDADKR
TEWIYRGSTRLGPLFLEVRKANARQQLQQSGNVHTRHRIPAPSNKNNLPYVEYTSNVEED
VTQHLQAEKTTVTTSVASTTPSTALQQPRAVAKKSTAKRQNNVDTTTYNSTVETKPSHSI
VFYHTQRKYEPKKYVAHKCGPRCIKGIKVSHDDLKGLSPLSIPLLCGWHRQLCKFSKGKK
VILYQTPCGVRLRNMEELHRYLRITNSTLSVDLFDFDYWVRAFADFVVEKCFINIKDLSY
GVENVPIPCVNDLDHTQPDTIRYTTRREPTEGVYLNLDPAFLCSCDCEDDCQDKEKCQCW
QLTIQGATLGGKMPNSAVGYIYKRLPEPVTTGIYECNSGCKCSVKTCLNRVVQHPLRLKL
QVFKTGPRGWGIRCLNDIPHGAFICIYAGRLLTEQGANEGGKNYGDEYLAELDYVEVVEG
FKEGYESDVLEPEILMSPTEDDNKKKATDVSDEEEDNTKESTNDSDEDFNIDSYVASCNN
DLLETTAESSSIRKRLRKRKRHEIDNQPDVSEENSDDESIMRGLENTAKSSTNENQDMIN
ISDDDDSRNDVRREPSRFEPNLEPNQIERPTFKSVRDYFGEDEAVYIMDAKTTGNIGRYL
NHSCDPNVFVQNVFVDTHDVRFPWVAFFALQYIKAGQELTWNYSYDVGSIPGKVIICKCG
AANCRGRLL
NT seq 3450 nt NT seq  +upstreamnt  +downstreamnt
atgagtctaatttcattaaaatcggaggaattgttcagcaaaacaattattcggaaaatg
gctcaagcacagagtgcagaaattattgaattgatgtcagatgaagacgagaaaaagaca
agaaaaaccaaatctaaagggtataatagtaattgcgtcaattttaaatgtcgctctggg
ataaatatgaaagtggcaccttccttcgcgtgcgcattttatggggtttcactcgagaag
aaaaagaaacgtataatatgtaaagaatgttttgatgctgctttgcaacatcagaagcaa
ttggtacaagcctttgtagaaaatagatcactattagattgttattttccggatcataca
atggaagtagaaatttctgatagcgatgattccgatgatgagaagaaaaaggagttagag
aaggataataacgaatacatcccggaagatgtacttctagatatcaaggataaattaaat
gacacattgtcacatatttacaaaaagtacaatgtggagcagcatgctaaagttgcatgt
gaaactttgaaacagagatggcgagacatatgcgcggcaaatgattctctcaataccgaa
atacgggaaataatgcgtactgtggataaattgcgtaacaacttatacgaagactttaga
ccgcaaattaaaatgctcgaggaattgcaaataaacgacgaaattacggagactgcccat
ccgcttgtagcaacgaaaaaagtaacacaagtacgtgttccgccttcttcgctgttgcaa
gataatcagctagaagttttagcgattgaaccatcatgtactaaggaaataataattcct
aatttaccaccgactggtccactccttaaacgctctccggagatagatgatatcgtttat
gttatgaaaagtccagttatgccatggattaaagcaaaggtattaaatatagtttcaaat
ccatggaatattcgcgtgagacttatccagaaaaagtataatgcagcaattaagactgtc
tctggcaaactgctagcgacaaccgaactgagtaaagttatgatcccagttggaacgcga
gttgtggcaatatttcacgatgttgtttctaataattactacagcggaataattgctgaa
acaccaaaatctataaataagtatagatatctcgtattttttgatgacggttacgctcag
tatgtcgtacataatgacatcctactagtttgggagacttcgccgcgcatttgggaggat
attcctagcgaatcgcgagagtttgtaaagaaatacctggaatcgtatcctgaaagacca
atggtgaaattgcaacctggtcaaatagttaagactgaatggaatggtaaatggtggctt
gcgagagtcgtacaggtcgatgcgagtttagtgcaaatgcattttgacgccgataagaga
actgaatggatttatcgtggatcgactagattgggccctttgtttctcgaagtacggaag
gccaatgcgaggcaacaacttcaacagtctggcaatgtacatactcgacatcgtattcct
gctccgtccaataaaaataatttaccttacgttgaatatacatccaacgttgaagaggat
gttacacaacatctgcaagcggagaaaacaacagttactacaagtgtagcgtctactaca
ccatccactgcactgcaacagccgcgtgcagtagctaaaaaaagtactgccaaaaggcaa
aataatgtagatactacaacgtacaattcaaccgtggaaacgaaaccgtcacatagtatc
gttttttatcatacacagaggaaatacgagccgaagaaatatgttgctcataaatgtggg
ccaagatgtattaagggtatcaaggtttcacatgacgatttaaaagggctttctccactc
tctattccgcttttatgcggctggcatcgccaactttgcaaattctctaagggcaagaaa
gttatattatatcagacaccgtgcggcgtcagattgcgaaatatggaagagctacatcgt
tatctccgcattaccaatagtacattatctgtcgatctatttgattttgattattgggtg
cgcgctttcgctgacttcgttgtagaaaaatgctttatcaacatcaaggatctcagttat
ggcgtggaaaatgtgccgataccatgtgtaaatgacttggatcacactcagccggatact
ataagatacactacacgtcgggagccaacggaaggtgtctatctaaatctagatcctgca
ttcttatgtagctgcgattgcgaagatgattgtcaggataaagagaaatgccaatgctgg
cagctaacaatacaaggggcaactttgggaggaaaaatgccaaacagcgctgttggttat
atttataaacgcttgccagaaccggtgaccacaggaatttacgaatgtaattcgggatgc
aagtgttccgtaaaaacgtgtctcaacagagtagtacagcatccgctcagattaaaatta
caagtgtttaaaacaggaccgcgtggttggggcataagatgcctcaatgatattccccat
ggcgcttttatctgcatttatgcaggaagattacttaccgaacagggcgcaaatgaaggg
ggtaaaaattatggtgatgagtatttggcagagttagattatgtggaagtggtagaaggt
ttcaaggagggttatgaaagtgatgttctcgaaccggaaatattaatgtcacctacagaa
gatgacaataagaaaaaagctactgacgtaagcgatgaggaagaggataatacaaaggaa
agcactaatgattcggacgaagatttcaatattgatagctatgtggcttcttgcaataat
gatttgttagaaacaaccgcggaatcttcgtccattaggaaacgtctgaggaaacggaaa
agacacgaaatagacaatcaaccagatgtatctgaagaaaacagcgatgatgaaagcatt
atgagaggtttggaaaatacagcaaaatcatccactaatgaaaatcaggatatgattaat
atcagtgatgacgatgatagtagaaatgacgtaagaagagagccaagtagattcgaacct
aatttagaaccaaatcaaatagaaagaccgacgtttaagtctgtgagagattatttcggt
gaagacgaagccgtttacattatggatgctaaaacgactggaaatatcggtcgttatttg
aatcactcttgcgatccaaacgtatttgtacaaaatgtgtttgtcgatacacatgacgtg
cgttttccatgggtggctttcttcgcgttacaatatataaaagctggacaagaacttaca
tggaattacagttatgacgtaggaagtataccgggcaaagtgatcatttgcaaatgcggt
gcagctaattgtagaggccgtcttctatga

DBGET integrated database retrieval system