KEGG   Altererythrobacter epoxidivorans: AMC99_02038Help
Entry
AMC99_02038       CDS       T04070                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
aep  Altererythrobacter epoxidivorans
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:aep00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AMC99_02038
  Energy metabolism
   00680 Methane metabolism
    AMC99_02038
Enzymes [BR:aep01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AMC99_02038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1976916..1979693
Genome map
AA seq 925 aa AA seqDB search
MKTVDQLIDRLSQHHLRTQETPLFNPVFQLGLDLSRELEGGEIDLDTLEALVAELECDSM
QSRSRRLRRLVAPVTPSENTEGLKKSLKAETFADFQAAWQRPQLHAVFTAHPTFLLPPEQ
SEAVAQAASSDREIGSDVCVLAPERPQVTLEYEHDRAMRAIANAQDARDSIVGELLDHAA
GKWPDQWQDLAPLPFRFASWVGYDMDGRTDIKWYDSIGFRLGEKTQRLSRYIASLERIDP
DHPLLGTLRPALAYAQARSADFAGDLTEPEALSAAANRLTADNPDKLLSLAPLIDALEEE
ACDADKDRAIALKTLAAAMRADGLGMGWIHFRVNSSQLHNAIRRRIDPDNALDLASKGAI
ATLREMLATVKPLRSNFAALAIESSTAIRQFLAMAQILAHIDADAPIRMLIAECEQPSTI
LAALYFAKLFGIEDKVDVSPLFETESALEHGGRFLDALLAEESYQQYARLRGRVAIQTGF
SDAGRFVGQIPASLAIERLQGRLSEAMEANGLTDVAALIFNTHGESMGRGAHPDSFEDRL
TWPLSPWAKRRFARAGIPLEPEVSFQGGDGYLFFSTPELARATLTRIAQIRPAETDTSAP
TDPLYRRTDLSLDFYRAIRSHQREHLHSKTYARAVTAFGLGLLNSTGSRVSRRQSDLAAD
REMNLRQIRAIPHNAILQQLGYPVNVIAGIGSAADGNYEEIASLLIESERGRQLVRLARS
SNALASIKTVAAYGELFNSAYWASRPYRGTESHLSDACEVLAEYLTKDDRAGVFRRLASR
LRVDALKLHRLLSLIPNEHPLEEREHIRRTIGAAQSLRLALLQHMFIKAVSIPAFSRAND
ISRDDVLEMVFTLRVDDALAQMRRAYPTNYPQITDFAVDAPSDYPDGDGEGYAAIQREYI
DPIERAYGLVLRLSTAIANEFGAHG
NT seq 2778 nt NT seq  +upstreamnt  +downstreamnt
atgaagacagttgaccagctgatagaccgattgagccagcatcacctgcggacgcaggag
acacccctgttcaacccggtcttccagcttggcctcgacctctcgcgcgaactcgagggc
ggggagatcgacctcgacacgctcgaagcgctggttgccgaactcgaatgcgacagcatg
cagagccgttcgcgtcgtctgcgaaggctggtcgcaccagtaacgccgtccgaaaacact
gaaggcctgaagaagtcgctgaaagcagagaccttcgcagatttccaggcagcatggcag
cgcccgcaattgcatgcggtcttcaccgcgcacccgaccttcctgctgccgcccgaacaa
tccgaggcggtcgcacaggctgccagcagcgatcgcgagatcggcagcgatgtctgcgtg
ctggcgccagagcgtccgcaggttacgcttgagtacgagcatgatcgtgccatgcgggcg
atcgcaaacgcccaggacgcacgcgattccatcgtcggcgagctactcgatcatgcggcg
ggcaaatggccggaccagtggcaggaccttgcgccgctgccgttccgtttcgcaagctgg
gtcggctatgacatggacggtcggaccgacatcaaatggtacgattcgatcggtttccgc
ctcggtgaaaagacccagcgactttcccgctatatcgcatcgctggagcggatagatccc
gatcacccgctgctcggcaccttgcgcccggcgctcgcttacgcgcaggcacgctcggcg
gatttcgcaggcgacctgacagaaccggaagcgctttcggcggctgccaacaggctgacg
gcggacaatccggacaagctgctgtcgctcgcaccgctgatcgatgcgctggaagaggag
gcgtgcgatgccgacaaggatcgcgccatcgccctcaagaccctcgccgcagccatgcgc
gcagacggtctgggaatgggctggatccacttccgcgtaaattccagccagctgcacaat
gcgatccgccgccggatcgatccggacaatgcgctggacctcgccagtaagggcgcgatt
gcaacgctgcgcgaaatgctcgcaacggtgaagccgctgcgatccaacttcgccgccctt
gcgatcgaaagctcgaccgcgatccgccagttcctcgcaatggcgcagatcctcgcccat
atcgacgccgacgcgccgatccgcatgctgatcgccgaatgcgaacagccttcgacgatc
cttgcagcgctctattttgccaagctgttcgggatcgaggacaaggtcgatgtttcgccc
ctgttcgaaaccgaaagcgccctcgaacatggtgggcggttcctcgacgcgctgctggca
gaggaaagctaccagcaatatgcgcgcctgcgtggacgggtcgcgatccagaccggcttt
tccgatgccggccggtttgtcggccagattcctgccagcctcgcaatcgaacgcctgcag
ggccgcctcagcgaggcgatggaggcaaacgggctgaccgatgtcgccgccctgatcttc
aacactcacggcgaaagcatgggtcgcggcgcgcatcccgacagtttcgaggatcgcctg
acctggccgctcagcccttgggccaagcgccgctttgcccgtgcaggcatcccgctcgaa
cccgaagtcagctttcagggcggcgatggctacctgtttttctcgacccccgaactggca
cgcgcaacgctgacgcgcatcgcccagatcaggcctgcagaaaccgacacctccgcgccg
accgatcccctctatcgccgtaccgacctcagcctagacttctatcgggcaatcaggtcg
caccagcgcgaacatctgcactcgaaaacctatgcccgcgcggtcaccgctttcggcctg
ggcctgctcaactcgaccggcagccgcgtttcccgccgccagagcgaccttgcggccgac
cgcgagatgaatttgcgccagatccgcgcgatcccgcacaatgccatcctgcagcagctc
ggctacccggtgaacgtgatcgccggtatcggcagcgcggcggacggcaattacgaggaa
atcgcctcgcttttgatcgagagcgagcgcggcaggcaactcgtgcgcctcgcccgcagc
tcgaatgccctggccagcatcaagaccgtcgcggcctatggcgaattgttcaacagcgcc
tattgggcaagcaggccctatcgcgggaccgaaagccacttgtcggatgcctgcgaagtg
ctggccgaatatcttaccaaggacgatcgagccggtgtatttcgccgcctcgcatcgcgc
ctgcgagtcgatgcgcttaaactgcatcgcctgctgtcgctgatcccgaacgagcaccct
ctcgaggaacgcgagcatatccgccgcacgataggcgctgcgcagtcgctgcgcctcgcc
ctgctgcagcacatgttcatcaaggcggtgtcgatcccggccttcagccgcgccaacgac
atcagccgcgacgacgttcttgaaatggtgttcacgttgcgggtggacgatgccctggca
cagatgcgccgtgcctacccgaccaactatccgcagatcaccgatttcgccgtcgatgcg
ccgagcgattatcccgatggcgatggcgaaggatacgccgccatccagcgtgaatatatt
gacccaatcgagcgcgcctatgggctggtgctccgcctttccaccgcgattgcaaacgag
ttcggcgcgcacggctag

DBGET integrated database retrieval system