KEGG   Actinobacillus equuli: ACEE_10225Help
Entry
ACEE_10225        CDS       T03501                                 

Gene name
tuf
Definition
(GenBank) elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
aeu  Actinobacillus equuli
Brite
Translation factors [BR:aeu03012]
 Eukaryotic Type
  Elongation factors
   ACEE_10225 (tuf)
 Prokaryotic Type
   ACEE_10225 (tuf)
Mitochondrial biogenesis [BR:aeu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    ACEE_10225 (tuf)
Exosome [BR:aeu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   ACEE_10225 (tuf)
  Exosomal proteins of breast cancer cells
   ACEE_10225 (tuf)
  Exosomal proteins of colorectal cancer cells
   ACEE_10225 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2160566..2161750
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKHFGGAARAFDQIDNAPEEKARG
ITINTSHVEYDTETRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALQALN
GVAEWEEKILELANHLDTYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKSG
EEVEIVGIKETTKTTVTGVEMFRKLLDEGRAGENVGALLRGTKREEIERGQVLAKPGTIT
PHTDFESEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMT
VSLIHPIAMDEGLRFAIREGGRTVGAGVVAKIIK
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaaatttgaacgtacaaaaccgcacgttaacgtgggtacaatcggccac
gttgaccatggtaaaacaactttaacagcagcgatcacaactgtattagcgaaacacttc
ggtggtgcagctcgtgcattcgaccaaatcgataacgcgccggaagaaaaagcgcgtggt
atcaccatcaacacttcacacgttgagtacgatacagaaacacgtcactacgcacacgtt
gactgcccgggacacgcggactatgttaaaaacatgattactggtgcggcacaaatggac
ggtgcaatcttagtagtagcagcgacagacggtccaatgccacaaactcgtgagcacatc
ttattaggtcgccaagtaggtgtaccatacatcatcgtattcttaaacaaatgcgacatg
gtagatgacgaagagttattagaattagtagaaatggaagttcgtgaacttctttctcaa
tacgatttcccaggtgacgatacaccaatcgtacgtggttcagcgttacaagcgttaaac
ggcgtagcggagtgggaagaaaaaattcttgagttagcgaaccacttagatacttacatt
ccagagccagagcgtgcgattgataaaccattcttattaccaatcgaagatgtattctca
atctcaggtcgtggtacagtagtaacaggtcgtgtagagcgtggtatcatcaaatcaggt
gaagaagttgaaatcgtaggtatcaaagagactacgaaaacaacagtaactggtgttgag
atgttccgtaaattattagacgaaggtcgtgcgggtgaaaacgttggtgcattattacgt
ggtacaaaacgtgaagaaatcgaacgtggtcaagtattagcgaaaccaggtacaatcaca
ccacacacagacttcgaatcagaagtatacgtattatcaaaagaagaaggtggtcgtcat
actccattcttcaaaggttaccgtccacagttctacttccgtacaacagacgtaacaggt
acaatcgagttacctgaaggcgtagagatggtaatgccaggcgataacatcaaaatgact
gtgagcttaattcacccaatcgcgatggacgaaggtttacgttttgcgattcgtgaaggt
ggccgtacagtaggtgcaggtgttgtagcgaaaatcatcaaataa

DBGET integrated database retrieval system