Anoplopoma fimbria (sablefish): 129107733 Help Entry 129107733         CDS       T09102                                  Symbol kras Name (RefSeq) GTPase KRas isoform X1   KO K07827   GTPase KRas Organism afb  Anoplopoma fimbria (sablefish) Pathway afb04010   MAPK signaling pathway afb04012   ErbB signaling pathway afb04068   FoxO signaling pathway afb04137   Mitophagy - animal afb04140   Autophagy - animal afb04150   mTOR signaling pathway afb04210   Apoptosis afb04218   Cellular senescence afb04370   VEGF signaling pathway afb04371   Apelin signaling pathway afb04540   Gap junction afb04625   C-type lectin receptor signaling pathway afb04810   Regulation of actin cytoskeleton afb04910   Insulin signaling pathway afb04912   GnRH signaling pathway afb04914   Progesterone-mediated oocyte maturation afb04916   Melanogenesis Brite KEGG Orthology (KO) [BR:afb00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     129107733 (kras)    04012 ErbB signaling pathway     129107733 (kras)    04370 VEGF signaling pathway     129107733 (kras)    04371 Apelin signaling pathway     129107733 (kras)    04068 FoxO signaling pathway     129107733 (kras)    04150 mTOR signaling pathway     129107733 (kras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     129107733 (kras)    04137 Mitophagy - animal     129107733 (kras)   09143 Cell growth and death    04210 Apoptosis     129107733 (kras)    04218 Cellular senescence     129107733 (kras)   09144 Cellular community - eukaryotes    04540 Gap junction     129107733 (kras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     129107733 (kras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     129107733 (kras)   09152 Endocrine system    04910 Insulin signaling pathway     129107733 (kras)    04912 GnRH signaling pathway     129107733 (kras)    04914 Progesterone-mediated oocyte maturation     129107733 (kras)    04916 Melanogenesis     129107733 (kras)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:afb04131]     129107733 (kras)   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:afb04031]     129107733 (kras) Membrane trafficking [BR:afb04131]  Endocytosis   Macropinocytosis    Ras GTPases     129107733 (kras) GTP-binding proteins [BR:afb04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     129107733 (kras) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 FeoB_N Septin Motif Other DBs NCBI-GeneID:  129107733 NCBI-ProteinID:  XP_054475235 LinkDB All DBs Position 19:5742869..5753509 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRLYRLNKLSKEEKTPRC VKLKKCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacagaatataagctggtagtggtgggagctggtggtgttggcaagagcgcacttact attcagctcatccagaatcactttgtggatgaatatgaccccaccatcgaggactcctac agaaagcaggttgtgatcgatggagagacgtgtctgctggacatcctggacactgcaggt caggaggagtacagcgccatgagggatcagtacatgaggacaggggagggcttcctctgt gtctttgccatcaacaataccaagtccttcgaagacattcaccactatagagaacagatt aagcgggtgaaggactctgaggacgtccccatggtgttggtggggaacaagtgtgacctc ccgtcccggacagtggacaccaagcaggctcaggacttagcacgcagctacggcattccc tttatcgagacatcagccaaaaccagacagagagtggaagatgccttttacactctggta cgggagatcaggctgtaccggctcaataagctcagcaaggaagaaaagactccgcgctgt gtcaagcttaaaaagtgtgttgtgatgtga

DBGET integrated database retrieval system