KEGG   Anoxybacillus flavithermus: Aflv_0876Help
Entry
Aflv_0876         CDS       T00790                                 

Gene name
sodA
Definition
(GenBank) Superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
afl  Anoxybacillus flavithermus
Brite
Enzymes [BR:afl01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Aflv_0876 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
894044..894652
Genome map
AA seq 202 aa AA seqDB search
MAFELPQLPYAYDALEPHIDKETMNIHHTKHHNAYVTNLNAALEGHPELQSKTIEELMAH
LNEVPENIRTAVRNNGGGHANHSLFWTILSPNGGGEPTGELAEAINNTFGSFEKFKEEFS
KAAATRFGSGWAWLVVHNGQLEVTSTPNQDTPLMEGKTPILGLDVWEHAYYLKYQNRRPD
YISAFWNVVNWDEVAKRYAAAK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgaattaccacaattgccttatgcttacgatgcgttggaaccacatattgat
aaggaaacgatgaacattcatcacacgaaacatcataacgcatatgtaacaaacttaaac
gcagcgcttgaaggtcatccagaattgcaaagcaaaacaatcgaagagctaatggctcat
ttaaacgaagtaccagaaaacattcgtacagctgttcgtaacaacggaggaggacatgca
aaccattcgctcttttggacaattctttcaccaaatggcggcggtgagccaacaggtgaa
ttagctgaagcaattaacaatacattcggtagctttgaaaagtttaaagaagaattttca
aaagccgctgcaacacgtttcggctctggttgggcatggcttgttgtgcataacggtcaa
cttgaagtaacaagtacaccaaaccaagatacgccattaatggaaggtaaaacaccaatt
ttaggattagatgtatgggagcatgcatactacttaaaataccaaaaccgtcgtccggat
tatatttcagcgttttggaatgttgtcaactgggacgaagttgcgaaacgttacgcagca
gcgaaataa

DBGET integrated database retrieval system