KEGG   Acidimicrobium ferrooxidans: Afer_0120Help
Entry
Afer_0120         CDS       T00956                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
afo  Acidimicrobium ferrooxidans
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:afo00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Afer_0120
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Afer_0120
Enzymes [BR:afo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Afer_0120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
131156..131494
Genome map
AA seq 112 aa AA seqDB search
MADVQEYRTSRRYELFSYLPQMTPEQIRKQVLYLISKGWNPSVEHVEPHRSMERFWYMWK
LPMFGEQSAEVVLAELEECRRAYPDHLVRLVGYDNYTQSQGIAFVVYRGQGS
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgttcaggagtatcgcacgtcacggcgctacgagctgttctcgtacctgccc
cagatgaccccggagcagattcgcaagcaggtgctgtacctgatctcgaagggctggaac
ccgagcgtggagcacgtcgagccccatcgctcgatggagcgcttctggtacatgtggaag
ctgccgatgttcggcgagcagtcggcggaggtggtgctcgccgagctcgaggagtgccgc
cgtgcctaccccgatcacctcgtgcggctcgtgggctacgacaactacacccagagccag
ggcatcgcgttcgtggtgtaccgaggccaggggtcctga

DBGET integrated database retrieval system