KEGG   Acidimicrobium ferrooxidans: Afer_0941Help
Entry
Afer_0941         CDS       T00956                                 

Definition
(GenBank) aminotransferase class-III
Organism
afo  Acidimicrobium ferrooxidans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
959275..960570
Genome map
AA seq 431 aa AA seqDB search
MDLIERHRRVLPSWLSLYYDEPIELDRGEGCWVWDAHGERYLDCFGGILTTSVGHNVPEI
VSAISDQAARVIHSSTLYLNRPMIELAERLAKASGIPDAKVFFTTSGTEANDAALLLATA
ALGSNQVFALRNSYHGRSFTEIAVTGNRTWSPTSYSPLSVSWLQGGSRLRGPLAGLSDAE
YVARGVADLEDALLTTTAGRVAALIAEPIQGVGGFCLPPDGYFGELWRVTQREGILWISD
EVQTGFGRTGEHFWGYEAHGITPDLITFAKGVGNGMSLAGVIGRAEVMDALGTNSISTFG
GSPITAAAGVATFDYIIDHDLMANARARGAELREGLDAIARSTPAIGEVRGKGLMQGVEL
VWPGTVEPAPELATRALEAARREGVLIGKGGLHGNVLRIAPPMTISAEQIEHALEAFRRS
FADQAFHVKEQ
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggacctcatcgaacggcatcggcgggtgctcccgtcatggctcagtctgtactacgac
gagccgatcgaactcgatcggggcgaaggatgctgggtgtgggacgcgcacggtgagcgc
tacctcgactgcttcggcggcatcttgacgacgagcgtcggtcacaacgttcccgagatc
gtgagcgcgatcagcgaccaggccgctcgggtgatccactcgtcgaccctgtatctgaac
cggcccatgatcgagctcgccgagcgtctcgccaaggcgtcgggcattcctgatgccaag
gtgttcttcacgacctcgggcaccgaggcgaacgacgcagccctgctcttggcgacggcc
gccctcgggtcgaaccaggtgttcgcgctgcgcaactcgtaccacggtcgctccttcacg
gagatcgcggtgaccgggaaccgaacctggtcgccgacgtcgtactcgccgctcagcgtc
agctggttgcaggggggttcgaggctgcgcgggccgctcgcgggtctctcggacgccgag
tacgtcgcgcgtggggtcgccgacttggaggatgcgctgctgacgacgacggccggacgg
gtggctgccctcatcgccgagccgatccagggagtcggcgggttctgtctcccgccggat
gggtacttcggtgagctgtggagggtgacccagcgcgaggggattctgtggatctccgac
gaggtccagaccgggttcgggcgtaccggcgagcatttctggggctacgaggcgcacggg
atcacgcctgatctcatcacgttcgccaagggtgtcggcaacggcatgtcgctcgctggc
gtgatcgggcgagcggaggtgatggacgcgctcgggaccaactccatctcgacctttggc
ggttcgccgatcacggcggcggcgggcgtggcgacgttcgactacatcatcgaccacgat
ctcatggccaacgcgcgtgcgcgcggcgccgagcttcgcgaggggctcgacgcgatcgct
cgatcgacgcccgcgatcggagaggtgcgcggcaagggcctcatgcagggggtcgagctc
gtctggcccggtacggtcgagccggcgcccgagcttgccacacgcgcgctcgaagcggca
cgtcgcgaaggcgtcctgatcggcaagggtggtctgcacggcaacgtcctgcgcatcgca
ccgcccatgaccatctcggccgagcagatcgagcacgcactcgaggcgttccggcggtcc
ttcgccgaccaggcattccatgtgaaggagcagtga

DBGET integrated database retrieval system