Aptenodytes forsteri (emperor penguin): 103896209 Help Entry 103896209         CDS       T08527                                  Symbol HRAS Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism afor  Aptenodytes forsteri (emperor penguin) Pathway afor04010   MAPK signaling pathway afor04012   ErbB signaling pathway afor04068   FoxO signaling pathway afor04137   Mitophagy - animal afor04140   Autophagy - animal afor04144   Endocytosis afor04150   mTOR signaling pathway afor04210   Apoptosis afor04218   Cellular senescence afor04370   VEGF signaling pathway afor04371   Apelin signaling pathway afor04510   Focal adhesion afor04540   Gap junction afor04625   C-type lectin receptor signaling pathway afor04810   Regulation of actin cytoskeleton afor04910   Insulin signaling pathway afor04912   GnRH signaling pathway afor04916   Melanogenesis afor05132   Salmonella infection Brite KEGG Orthology (KO) [BR:afor00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103896209 (HRAS)    04012 ErbB signaling pathway     103896209 (HRAS)    04370 VEGF signaling pathway     103896209 (HRAS)    04371 Apelin signaling pathway     103896209 (HRAS)    04068 FoxO signaling pathway     103896209 (HRAS)    04150 mTOR signaling pathway     103896209 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     103896209 (HRAS)    04140 Autophagy - animal     103896209 (HRAS)    04137 Mitophagy - animal     103896209 (HRAS)   09143 Cell growth and death    04210 Apoptosis     103896209 (HRAS)    04218 Cellular senescence     103896209 (HRAS)   09144 Cellular community - eukaryotes    04510 Focal adhesion     103896209 (HRAS)    04540 Gap junction     103896209 (HRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     103896209 (HRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     103896209 (HRAS)   09152 Endocrine system    04910 Insulin signaling pathway     103896209 (HRAS)    04912 GnRH signaling pathway     103896209 (HRAS)    04916 Melanogenesis     103896209 (HRAS)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103896209 (HRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:afor04131]     103896209 (HRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:afor04147]     103896209 (HRAS)    04031 GTP-binding proteins [BR:afor04031]     103896209 (HRAS) Membrane trafficking [BR:afor04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     103896209 (HRAS)  Endocytosis   Macropinocytosis    Ras GTPases     103896209 (HRAS) Exosome [BR:afor04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    103896209 (HRAS)   Exosomal proteins of colorectal cancer cells    103896209 (HRAS) GTP-binding proteins [BR:afor04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     103896209 (HRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N G-alpha ATP_bind_1 Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  103896209 NCBI-ProteinID:  XP_009274282 UniProt:  A0A087QVR0 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVETRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG CMNCKCVIS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgaccgaatacaagctggtggtggtgggagctggtggtgtcgggaagagtgctttgacg atacagctcattcagaaccatttcgttgatgagtatgaccccacgatagaggattcctac agaaagcaggttgtcatcgatggagagacctgcttgttagacatcttggatactgcaggg caagaggagtacagtgccatgagagaccagtacatgagaacgggggaaggattcctctgc gtctttgccatcaacaacaccaagtcctttgaagatattcaccagtacagggagcagatc aagagggtgaaagactcagatgatgttcccatggtgctggtgggaaataaatgtgaccta ccagcccggacagtggagacccggcaagcgcaggacctggcccggagttatgggatccct tacatagaaacgtctgccaaaactagacagggtgttgaagatgccttctataccttggtg cgggagatccgtcagcacaagctgcgcaagctgaatcccccagatgagagcggccctggc tgcatgaactgtaaatgtgtgatatcgtga

DBGET integrated database retrieval system