KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_1883Help
Entry
AFE_1883          CDS       T00810                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Pathway
afr00620  Pyruvate metabolism
afr00680  Methane metabolism
afr00710  Carbon fixation in photosynthetic organisms
afr01100  Metabolic pathways
afr01120  Microbial metabolism in diverse environments
afr01200  Carbon metabolism
Module
afr_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:afr00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AFE_1883 (ppc)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AFE_1883 (ppc)
   00680 Methane metabolism
    AFE_1883 (ppc)
Enzymes [BR:afr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AFE_1883 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 DUF4477
Motif
Other DBs
NCBI-ProteinID: ACK80073
UniProt: B7JBY5
LinkDB All DBs
Position
complement(1639731..1642520)
Genome map
AA seq 929 aa AA seqDB search
MEKKALNGKALRNRVKLLGNLLGEVLREQAGHRVFNAVEQLRQGYIRLHKREDLRLRERL
ARFIDALPQDDLVLVIRAFNTYFSLVNIAEEEFQHLHRRRLLQKGSMLWTGSFEETFREL
QGQGINPGQLQFLLDQIRYLPVFTAHPTESKRRTVLHALRRIFVTSKMLDDSALNDEEEQ
EVMDNLRAQIQILWETEEVRTNKPQVQDEVENGLFYFRDSLFEAVPLTYRAARRAARRVF
ANADIDIPAFIRFGSWIGGDRDGNPNVTAAITGWALRTQSIEVLKEYQQRLSDLYQLLGH
SSRFCAISPVLLASLERDADDFPELAEWVDQRFPSEPYRRKLRYMMTRLDLRLRQLENGQ
VLNESAGPAYAAAEDFLDDLLLVRDSLRGHNDGYIADNEVQEIIWLVQTFGFHLANLDIR
QESSVHSRTIAELFAGIPGFANYVELSEEARMLALSDALRRPGPLVEQAPDLSPMAAETC
AMFRCIAQLRREVSTAGFGNYVISMTHEASHIMEVLVLAKEFGLAGWSRQGLYSEIAVTP
LFETIHDLERMDTVMSTLLDNPVYAKILGSQDDIQEVMLGYSDSCKDGGILSSSWSLYQA
QLRLAALADKRKIRIRVFHGRGGSVGRGGGPTYEAILAQPPDTVRGQIKITEQGEVLSFK
YANLETAVYELTVGTAGLIKASIGLVRSASGDNPDHLKIMAELTRTGEAVYRDLTEGTPG
FMDYFYEATPLNEIAHMNIGSRPSHRQRGDRSMSSIRAIPWIFAWAQSRHVLPAWYGLGS
ALARWREDKPERLQALQDMYRHWPFFRALMGNIGMAMAKTDMAIAGEYAGLPNDRDAAIA
IYRKIQAEFESSQAEMLAIVGADHLLADNPTLAFSLQRRNVYMEPLNHIQLALLRRYRND
ETPPEFREIWLDPLLRTINAISAGQRNTG
NT seq 2790 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaaaaaggccctcaacggtaaagcgctccgtaaccgcgtcaagttgctcggcaac
ctgctgggagaggttctgcgcgaacaggccgggcatcgcgtattcaacgccgtggagcaa
ctgcgtcagggatacattcgcctccacaagcgggaggaccttcgcctccgggagcgactc
gcccgctttatcgacgcccttccccaggacgatctggtcctggtcatccgtgcgtttaac
acctatttcagcttggtcaacatcgccgaagaggagttccagcacctgcaccgccgccgt
ctgctccaaaagggaagcatgctgtggacagggtccttcgaggaaaccttccgcgaattg
caaggccagggtatcaaccccggacaattgcaatttctcctggatcagatccgttatctg
ccggtattcacggcacaccccacggagtccaagcgccgaacggtcctccatgccctgcgc
cgcattttcgtgaccagcaagatgctcgacgattctgcgctcaatgacgaagaagaacag
gaggtgatggacaacctgcgggcgcagatccagatactctgggaaacggaagaggtgcgc
accaacaagccacaggtgcaggatgaggtggaaaacggtctgttctacttccgcgacagc
ctgttcgaggcggtacctctcacttatcgggccgcgcgccgggccgcgcgccgggttttt
gcaaatgccgacatcgatattcccgcgtttatccgctttggttcctggatcgggggggac
cgggacggcaaccccaatgttaccgcggccattaccggctgggctttgcgcacccagagc
attgaagtattgaaagaatatcagcagcgtctgagcgacctctatcagttgctcggacat
tccagccgattctgtgccatctctcccgttctgcttgcttcattggagcgtgatgcggac
gactttccagaacttgcggagtgggtggaccaacgtttccccagtgagccctatcgccgc
aaactgcggtacatgatgacccgtctcgacttgcgtctgcgccaactggaaaacggtcag
gtcttgaatgagtcggcgggccccgcctatgccgcagcggaggatttccttgatgacctt
ttgctggtacgtgactcactgcgtggccacaatgacgggtatatcgccgacaacgaggtc
caggagatcatatggctggtccagaccttcggctttcacctggccaacctggacatccgc
caggaatcttccgtgcactcccgcaccatcgccgagcttttcgccggaattccaggcttc
gccaactacgtggagctttccgaagaagcgcgcatgctggcgctctccgacgcgctgcgc
cgccccggtccgctggtggagcaagcgcctgacctgtcccctatggcggcggaaacctgc
gcgatgttccgctgcatcgcccagctacggcgtgaagtcagcaccgccggctttggcaac
tacgtcatctccatgacccatgaggcaagccacattatggaggtactggtacttgccaag
gagttcggcctggccggatggtcacggcagggtctctacagcgagatcgccgttaccccg
ctgtttgaaaccattcacgatctggagcgtatggatacggtgatgtccaccctgctggac
aacccggtttacgccaagattctcggcagtcaggatgacatccaggaggtgatgctgggc
tattccgactcctgcaaagatggcggcatactttcttccagttggtccctgtatcaggcc
cagctacggctggcagccctggcagacaaacggaagatacggattcgggtttttcacggt
cgcggcggcagtgtgggccgtggcggtggccccacctatgaagccatactggcacaacca
ccagatacggtacgcgggcagatcaaaattaccgaacagggcgaggtgctttccttcaag
tacgccaatctggagactgcggtgtatgaactgaccgtaggtacggcgggtctcatcaag
gcgagcataggactggttcggtcagcatctggtgacaacccggaccatctgaaaatcatg
gcggaactcaccaggactggggaggctgtataccgcgatctcacggaaggcaccccaggg
ttcatggattatttctacgaggccacccccctcaacgaaatcgcccacatgaacatcggc
tcgcgcccctcccatcgccagcgcggcgatcgctccatgtcctccatccgcgccattccg
tggatatttgcctgggctcagtcacgacatgttcttccggcatggtacggcctcggttcc
gccctcgcccgctggcgggaggacaagccggaacgtttgcaggcactacaggacatgtac
cggcactggccgttctttcgggcgctcatggggaatatcggcatggcgatggccaagacc
gacatggcgattgccggagaatacgcaggcttacccaacgaccgggacgccgccatcgca
atctaccgtaaaattcaggcagaatttgaaagcagtcaggcggagatgctcgccatcgtc
ggggctgaccatttgcttgccgacaacccaaccctggcgttctccctgcaacggcgcaat
gtgtatatggagcctctgaatcatattcaactcgcgttgctgcggcgctatcgcaacgac
gagacccccccggaattccgggagatatggctggatcccctgctgcgcaccatcaacgcc
atatccgccggtcagcgcaatactggttaa

DBGET integrated database retrieval system