KEGG   Actinoplanes friuliensis: AFR_02065Help
Entry
AFR_02065         CDS       T02892                                 

Definition
(GenBank) hypothetical protein
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
afs  Actinoplanes friuliensis
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:afs00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    AFR_02065
Enzymes [BR:afs01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AFR_02065
DNA repair and recombination proteins [BR:afs03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     AFR_02065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
439994..440899
Genome map
AA seq 301 aa AA seqDB search
MAPSRVPVQIEGRDLELSNLDKVMYPAAGFTKGEVIDYYTRIAPVLLPHLQGRALTRIRY
PNGVDGAHFFEKNAPGGTPSWVRLETLPVPGSTKSRETIDFVVVDELATLVWVANLASLE
LHTPQWRIGEDPDLMVVDLDPGAPAGLTECCGVAVLMRDRLAEDGITAYPKTSGKKGMQL
CCPISGEQDAEVVSGYARKVAEELAAMVPGSITAKMARAIRPGKVFIDWSQNAAAKTTVA
PYSLRALESPSASTPLTWDEVEAFATGAAQARQFGAAELLERVEEHGDLLEDLLEPGPRL
P
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggctcctagccgggtaccggtccagatcgagggacgtgacctcgagctctccaacctc
gacaaggtcatgtacccggccgcgggcttcaccaagggtgaggtcatcgactactacacg
cggatcgctccggtgctgctgccgcacctccagggtcgtgcgctgacccggatccgctat
ccgaacggcgtcgacggcgcgcacttcttcgagaagaacgctccgggcgggacaccctcc
tgggtacgcctggagacgctgccggtcccgggctcgacaaaatcccgcgagacgatcgac
ttcgtggtggtcgacgagctggccacgctcgtctgggtcgccaacctggcgtcactggag
ttgcacacacctcagtggcgtatcggcgaggaccccgacctgatggtggtcgacctggat
ccgggtgcgccggcggggctcacggagtgctgcggggtggcggtgctgatgcgagaccgg
ctggccgaggacggcatcaccgcgtacccgaagacgtccgggaaaaagggcatgcagttg
tgctgtccgatctcgggtgagcaggacgccgaggtggtctcgggttatgcccggaaggtg
gccgaggagctggcggccatggtcccgggctcgatcaccgccaagatggcccgcgcgatc
cggcccggcaaggttttcatcgactggagccagaacgccgcggccaagacgacggtggcg
ccgtactcgctgcgggcgctggagtcgccgagcgcgtcgacgccgctcacctgggacgag
gtggaggccttcgcgacgggtgctgcgcaggcccggcagttcggcgccgccgagctgctg
gagcgcgtcgaggagcacggtgacctgctggaagacctcctcgagcccggtccgcgcctg
ccctga

DBGET integrated database retrieval system