KEGG   Actinoplanes friuliensis: AFR_27540Help
Entry
AFR_27540         CDS       T02892                                 

Definition
(GenBank) class III aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
afs  Actinoplanes friuliensis
Pathway
afs00250  Alanine, aspartate and glutamate metabolism
afs00410  beta-Alanine metabolism
afs00640  Propanoate metabolism
afs00650  Butanoate metabolism
afs01100  Metabolic pathways
afs01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:afs00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AFR_27540
   00650 Butanoate metabolism
    AFR_27540
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AFR_27540
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AFR_27540
Enzymes [BR:afs01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AFR_27540
Amino acid related enzymes [BR:afs01007]
 Aminotransferase (transaminase)
  Class III
   AFR_27540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AGZ43769
UniProt: U5W3Q6
LinkDB All DBs
Position
complement(5980334..5981635)
Genome map
AA seq 433 aa AA seqDB search
MTDDLLARHQAVMPSWVTTYYGDNAIELVSGSGRRVTDAAGRTYLDFFGGVLTNMLGYDI
AEVREAVERQLATGIVHSSTLYLIRQQVELAEKIARVSGIPDARVFFTNSGTEANEAALL
FTTNHRRSNQILAIRNSYHGRSFAAMAITGHRSWSASALSPVSVSWLNSGERLRGRMKGL
SDADHIDAAVEDLREVLATTTSGDVAALIAEPIQGVGGFVHAPDGLLGALKKELDNHGIL
LIADEVQTGWGRTGDHFWGYQAHDVQPDLITFAKGIGNGFALAGVVGRAELVNAVPATSF
STFGGNPISTAAGNAVLDYVLDHDLQANAARTGTILLDGLRAALGDTKIVGEIRGRGLMI
GIEFVRPGTTDPDTAATMRVFDECRKGGLLVGKGGLYGNVLRMGPPLTLTEDEAREGLAI
LTEAIRTADAESF
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgatgacctgctcgcccggcaccaggccgtcatgccctcctgggtgacgacgtac
tacggcgacaacgcgatcgagctggtgagcggctccggccggcgtgtcaccgacgccgcc
ggacgcacctacctggacttcttcggcggcgtgctgaccaacatgctcgggtacgacatc
gccgaggtgcgcgaggccgtcgaacgccagctcgccaccggcatcgtccacagctccacg
ctgtacctgatccggcagcaggtcgaactggccgagaagatcgcccgcgtctccggcatc
ccggacgcccgggtcttcttcaccaactccggcaccgaggccaacgaggccgcgctgctc
ttcaccacgaaccaccgccgctccaaccagatcctggcgatccgcaacagctaccacggc
cgctccttcgcggcgatggccatcacgggtcaccgcagctggtcggccagcgccctgagc
ccggtcagcgtctcctggctgaactccggcgaacgcctccgcggccgcatgaagggcctc
tccgacgccgaccacatcgacgcggccgtcgaagacctccgcgaagtcctggccaccacc
acctccggcgacgtggccgccctgatcgccgaaccgatccagggcgtcggcggttttgtc
cacgcccccgacggcctgctgggcgctttgaagaaggaactcgacaaccacggcatcctg
ctcatcgccgacgaggtccagaccggctgggggcgtacgggtgaccatttctgggggtac
caggcccacgacgtccagcccgacctgatcaccttcgccaagggcatcggcaacggcttc
gccctggccggcgtcgtcggccgcgccgagctggtcaacgccgtcccggccacgagcttc
tccaccttcggcggcaacccgatctcgacggcagcaggcaacgccgtcctggactacgtc
ctcgaccacgacctccaggccaacgccgcacgcaccggcacgatcctcctcgacggcctc
cgcgcagcgctcggcgacaccaagatcgtcggcgagatccgcggccgcggcctgatgatc
ggcatcgagttcgtccgccccggcaccaccgaccccgacacggccgcgaccatgcgcgtc
ttcgacgaatgccgcaagggcggcctgctggtcggcaagggcggcctctacggcaacgtc
ctccgcatgggcccgcccctcaccctcaccgaggacgaggcccgcgaaggcctcgccatc
ctgaccgaagccatccgcaccgccgacgccgaatccttctga

DBGET integrated database retrieval system