Actinoplanes friuliensis: AFR_38360 Help Entry AFR_38360         CDS       T02892                                  Name (GenBank) glutaredoxin-like protein   KO K18917   mycoredoxin [EC:1.20.4.3] Organism afs  Actinoplanes friuliensis Brite KEGG Orthology (KO) [BR:afs00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     AFR_38360 Enzymes [BR:afs01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      AFR_38360 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 GST_N_3 Glrx-like Thioredoxin_2 Thioredoxin Motif Other DBs NCBI-ProteinID:  AGZ45926 UniProt:  U5WD99 LinkDB All DBs Position 8369796..8370038 Genome browser AA seq 80 aa AA seqDB search MLTMYSTSWCGYCHRLKSQLDREGIQYDVVDIEQDPASADFVMSVNGGNQTVPTLRFDDG SALTNPSIVQVKEHLAALAA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgttgaccatgtactcgacgtcctggtgtggttactgccaccggctcaagtcgcagctc gaccgggaaggcatccagtacgacgtcgtcgacatcgagcaggacccggcctcggccgac ttcgtgatgagcgtcaacggcggcaaccagacggtcccgacgctgcgcttcgacgacggc tcggccctgacgaacccgtcgatcgtgcaggtcaaggaacatctggctgcgctggccgcc tga

DBGET integrated database retrieval system