KEGG   Addendum: AAG02359Help
Entry
AAG02359          CDS       T10000                                 

Gene name
blmVI
Definition
(KEGG) nonribosomal peptide synthetase protein BlmVI
  KO
K16106  
nonribosomal peptide synthetase protein BlmVI
Taxonomy
TAX:29309
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces verticillus)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
GB: 
UniProt: 
LinkDB All DBs
AA seq 2675 aa AA seqDB search
MSRPAGIVDIARRHAERTPARPAYAFLPDGETESVRFSFADIDRRARAVAAVLQDRGLAG
ERVLVAYPSGPEYVQAFLGCLYAGVVAVPCDEPRSGPSAERLAGIRADARPALALTAGAP
EAGLAGLATLDVAGVPDSAAGAWTDPVAGPDALAFLQYTSGSTRRPRGVMVGHGNLLANE
RCIAAACGHDRDSTFVGWAPFFHDMGLVANLLQPLYLGSLSVLMPPMAFLQRPARWLRAV
SRYRAHTSGGPNFAYDLCVDRVGEDERAGLDLSGWKVAYNGAEPVRADTLRRFTDRFAPH
GFTPGAHFPTYGLAEATLLVATGPKGVPPRTLTADRAALRAGRLRPAGPGEAGLELVGNG
TAGLDTTLRIVDPATARECPPGEVGEVWVRGPGVARGYFGRPRESAPLLAARLPGGEGPY
LRTGDLGALHDGELFLTGRHKDLIVIRGQNHHPHDLERTAEQAHPALRPTCAAAFAVPGD
GAERLVLVCELTSYRAVDPAAVAEAVRAALAARHGVAPHTLVVLRRGGIPKTTSGKVRRG
HCRTAYLDGTLPVHTAVRLPAGEEGTEALPLTTDPGRLATALRDLAAAHAGLAGPLPGTD
EPVSALGLDSLASLRLHHHVQSAYGVTLPVTALLGDTTYRRLAELTLAAPRPARAPEGQV
TGVWRPLTHGQRALWYEQALAPHAAAYHLVRALALRGPVDEEALAEAVRRVVRRHPALRT
RFALRDGEPARRTEPYGPELDVRDATGLPADRLREHLAAAGDRPFDLAAGDRPVRLTLYR
TDGGHILLLVAHHLVADFWSLVVLLGDLARAHAGEDLPPAPEGDPGDEATDADRTYWRHR
LADAPPALDLPTDLPHPAERGFAGATHAFRLPPDLTARLTALSRERHCTLFTTLLAAHQL
LLHRLTGQDDLVVGTLLARRDTAEAAGAVGYLVNPLPLRSVREPGETFTELLRRTRRTVL
DAVAHGRHPFGPLVSRLAPARTPGRAPLLQSLFVLQREYGDEADGYRALALGVGGRLRVG
GLDLEALALPRRWSQLDLSLSMARLGDGLTGVWEYRTDLFTEATVAELSEAFVHLLRAAV
EDPGAPVETLPLTGGRETGPRRGPSAARPALPLHRLVAAAARRDPARTAVVALAPDGTAH
HISHGALHRAATTLAARLRREGAGPERPVAVLVERGPWLPVAYLGILHAGATVLPLDPED
PPHRLARTIANSGARLLLTETGTASRAAEAAGPGVRALTVREGATGGERFSADVHPEQSA
YLLYTSGSTGDPKGVLVPHRAIVNRLLWMQETYRLRPGERVLHKTPVTFDVSMWELLWPL
TAGATVVMARPGTHRDPARLVRRIAREAVTTVHFVPSMLTPFLTELARGTTRLPALRRVV
CSGEELPAAAVNRAAGLLDARLYNLYGPTEAAVDVTAWPCRPPEPGPVPIGLPIANTTTE
VLDGRLRPLPRPVPGELYLGGACLAHGYHHDPALTAARFLPAPGGGRRYRTGDLVRQRAD
GALVFRGRTDDQVKIGGIRVEPGEVAEALRALPGVADAAVVPHDGRLAAYAVADPVGPAP
AADALRDALRRRLPGHLVPAALTLLDRLPLTPAGKLDRRALPHPSAPPPDGGRPPTTGTE
RLVARVWAERLGREVVGVDRDFFSLGGDSVRALGVTAALRAAGLPVTVTDLLRLPTVAAL
ARHADERADRRPARQETPPGPFALCPEAAGVPGLEDAYPMSMAQRAVLFHRDHNPGYEVY
VTSVAVSTPLDRTRLAAAVDRLLDRHAYLRSSFDLVSHPEPTQLVWTHLPTPLEVVESSD
PAGFDAWLHAERKRPLDVGTGPLARFTAHDAGAAGFRLTVSSFALDGWCVATVLTELLRD
YWSALRGAPLSLPAPAASYREFVALERAAQHDPAHREFWRTELAGARPHPLPRRPVPPPG
PDGIRQHRHVVPVEDTVAKGLSALAGELGVGLKHVLLGVHLRVVRALSGDPDVITAVETH
GRLERHDGDRVLGVFNNILPLRQRVDGGSWADLARAAHAAEARTGEYRRYPLAQAQRDHG
AAGLFDTLFVFTHFHLYRALADLDGMAVSDLRAPDQTYVPLTAHFNVDATDGGGLRLLLE
SDPREFPDEQVAEFAAYYRRALRAAADAPHRPYRDTPLTDRPAGPAPHRAERSVHALFAA
PARNHPDRIALDGEDGPVSHGALARRAARLAGTLRAAGAGPDTVVGIWAPRRADAVVALL
AALHAGAAYLPLDPVHPPRRQRQVLTEAGARLLVLPAGLDTPLRACGLPVVAPDDLGAPI
APVSVHPEQLAAVMATSGSTGTPKTIGVPQRALAGYLRWAIGHYRLDEETVSPVHSSLGF
DLTVTALLAPLAAGGQARLTDSGDPGALGAALAAGHHTLLKITPAHLAALAHQLGAPTAL
RTVVAGGEPLHAGHVRALRAFAPGARLVNEYGPTETTVGCCAHDVAPDPGEAPIPVGTPI
AGLSACVVDDALPAPPGVRGELYIGGTGVTRGYLGRPAATAAAYVPDPAAPGARRYRTGD
LARRLPDGTLLLAGRADRQVKIRGHRVEPGEVEQVLGGHPGVREAAVVAHPAPGGGRRLV
AYWVPAEPARPPSADALTALLADRLPPYAVPAELVRLPALPTTPNGKVDHTRLPAAGRDR
RLAELLDRIEALSDAEAASALRDSRPAPGSGDDRA
Reference
  Authors
Du L, Sanchez C, Chen M, Edwards DJ, Shen B.
  Title
The biosynthetic gene cluster for the antitumor drug bleomycin from Streptomyces verticillus ATCC15003 supporting functional interactions between nonribosomal peptide synthetases and a polyketide synthase.
  Journal
Chem Biol 7:623-42 (2000)
DOI:10.1016/S1074-5521(00)00011-9
Reference
  Authors
Du L, Chen M, Sanchez C, Shen B
  Title
An oxidation domain in the BlmIII non-ribosomal peptide synthetase probably catalyzing thiazole formation in the biosynthesis of the anti-tumor drug bleomycin in Streptomyces verticillus ATCC15003.
  Journal
FEMS Microbiol Lett 189:171-5 (2000)
DOI:10.1111/j.1574-6968.2000.tb09225.x

DBGET integrated database retrieval system