KEGG   Anoxybacillus gonensis: AFK25_10175Help
Entry
AFK25_10175       CDS       T04000                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
agn  Anoxybacillus gonensis
Brite
Enzymes [BR:agn01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AFK25_10175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AKS38928
UniProt: A0A0A2SGX0
LinkDB All DBs
Position
complement(1930858..1931466)
Genome map
AA seq 202 aa AA seqDB search
MAFELPQLPYAYDALEPHIDKETMNIHHTKHHNAYVTNLNAALEGHPELQNKTIEELMAN
LDAVPENIRTAVRNNGGGHANHSLFWTILSPNGGGEPTGELAEAINRTFGSFEKFKEEFS
KAAATRFGSGWAWLVVHNGQLEVTSTPNQDTPLMEGKTPILGLDVWEHAYYLKYQNRRPD
YISAFWNVVNWDEVAKRYAAAK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgaattaccacaattgccttatgcttacgacgcgttagaaccacatatcgac
aaagaaacgatgaacattcatcacacaaaacatcataacgcgtatgtaacaaatttaaac
gcagcgcttgaaggtcatccagaattgcaaaacaaaacaattgaagagttaatggcgaat
ttagatgcagtacctgaaaatattcgcacagctgttcgtaacaacggaggcggacatgcg
aaccattcgctcttttggactattctttcaccaaatggcggcggtgaacctacaggtgaa
ctcgctgaagcaatcaatcgtacgtttggaagcttcgaaaaatttaaagaagaattttcg
aaagctgctgcaacacgtttcggttctggatgggcttggcttgttgttcataacggtcaa
cttgaagtaacaagcacgccaaaccaagatacaccgttaatggaaggaaaaacaccaatt
ttaggattagacgtatgggagcatgcgtattacttaaaatatcaaaaccgccgtccagat
tatatttcagcattttggaatgttgttaactgggacgaagttgcaaagcgttacgcagca
gcgaaataa

DBGET integrated database retrieval system