KEGG   Anoxybacillus gonensis: AFK25_11610Help
Entry
AFK25_11610       CDS       T04000                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
agn  Anoxybacillus gonensis
Pathway
agn00020  Citrate cycle (TCA cycle)
agn00480  Glutathione metabolism
agn01100  Metabolic pathways
agn01110  Biosynthesis of secondary metabolites
agn01120  Microbial metabolism in diverse environments
agn01130  Biosynthesis of antibiotics
agn01200  Carbon metabolism
agn01210  2-Oxocarboxylic acid metabolism
agn01230  Biosynthesis of amino acids
Module
agn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
agn_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:agn00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AFK25_11610
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AFK25_11610
Enzymes [BR:agn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     AFK25_11610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AKS39212
UniProt: A0A0A2SK66
LinkDB All DBs
Position
complement(2219446..2220720)
Genome map
AA seq 424 aa AA seqDB search
MMQGEKITVTNGVLNVPNYPIIPFIEGDGTGPDIWAAASRVLEAAVEKAYKGERKIVWKE
VLAGEKAFKLTGEWLPQETLDTIREYIIAIKGPLTTPVGGGIRSLNVALRQELDLFVCLR
PVRYFKGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAKGTPEVKKVIDFLQNEMGVRKIR
FPETSGIGIKPISEEGTKRLVRAAIKYAIEHGRKSVTLVHKGNIMKYTEGAFKNWGYELA
EQEFGDQVFTWAEYDRIVEAHGKEAANKAQAEAEAAGKIIIKDAIADIFLQQILTRPREF
DVVATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLDKVNPS
SVILSGVMMFEHLGWNEAAKLIIDSMEKTIASKVVTYDFARLMEGATEVKCSEFADALIR
NMSE
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaaggagaaaaaattacagttacaaacggagtattaaacgttccaaattaccca
attatcccatttatcgaaggggacgggacaggcccggatatttgggcagccgcttctcgc
gtattggaagcagctgttgaaaaagcgtataaaggtgaacgaaaaatcgtttggaaagaa
gtgcttgctggtgaaaaagcgtttaagttgacaggtgaatggttgccacaagaaacactt
gatacgattcgtgaatacataattgcgattaaaggtccgttaacaacgccagtaggtgga
ggcattcgctccttaaacgttgcgcttcgccaagagctcgatttatttgtatgcttacgt
ccggttcgctattttaaaggagttccttctccagttaagcgtcctgaagatacagatatg
gtcattttccgtgaaaatacggaagatatttatgctggaatcgaatatgcgaaaggaacg
ccagaagtaaaaaaagtgatcgatttcttacaaaatgaaatgggcgtacgcaaaatccgc
ttccctgaaacgtcaggaatcggcattaagccaatttcagaagaaggaacgaaacgatta
gtgcgggcggcgattaaatatgcgattgaacacggccgcaaatctgtgacgctcgttcat
aaaggaaacattatgaaatatacagaaggtgcgtttaaaaactggggttacgaattagct
gagcaagaatttggcgatcaagtgtttacatgggcggagtatgatcgcatcgttgaagcg
catggaaaagaagctgcaaacaaagcgcaggcggaagcagaagcagcaggaaaaattatc
attaaagatgcgattgcagatattttcttacaacaaattttaactcgtccacgcgagttt
gatgttgttgcgacgatgaacttaaacggcgattacatttctgatgcgcttgcagcacaa
gtaggcggcatcggtattgctccaggtgcaaacattaactatgaaacaggtcatgcaatt
tttgaagcaacgcatggcacggcaccaaaatatgcaggattagataaagtaaatccgtca
tcggtcattttatctggtgtaatgatgtttgaacatctcggttggaacgaagcagcgaaa
ctcattattgactctatggaaaaaacaattgcatctaaagtggtcacatatgattttgcg
cgcttaatggaaggtgcaacagaagtgaaatgctctgaatttgcggatgctctcattcga
aatatgagcgaataa

DBGET integrated database retrieval system