KEGG   Anoxybacillus gonensis: AFK25_13940Help
Entry
AFK25_13940       CDS       T04000                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
agn  Anoxybacillus gonensis
Pathway
agn00240  Pyrimidine metabolism
agn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:agn00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    AFK25_13940
Enzymes [BR:agn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     AFK25_13940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_14 IMPDH AAA_19
Motif
Other DBs
NCBI-ProteinID: AKS39637
UniProt: A0A0A2SPX7
LinkDB All DBs
Position
complement(2660142..2660762)
Genome map
AA seq 206 aa AA seqDB search
MYVMKQSGWLEVICGSMFSGKSEELIRRVRRAQFAKQEVKVFKPAIDNRYSEEAVVSHNG
TSVIAIPVSCALDIRKHISTHTDVVAIDEVQFFDEHVVDVVQQLADEGYRVIVAGLDQDF
RGEPFGPVPTLMSIAESVTKLQAVCTVCGSPASRTQRLINGRPASYHDPVILIGASESYE
PRCRHHHEVPDHPKKNKTCKETATRP
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgtatgtcatgaagcaatccggctggctagaagtcatttgcgggagcatgttttccgga
aaatcggaggagctcattcgtcgcgtacgacgcgcgcagtttgcgaaacaagaagtgaaa
gtgtttaagccagcgatcgataatcgatatagcgaagaagcagtcgtttctcataatgga
acatctgttatcgccatccctgtttcttgtgcgctagacattcgaaagcacatctccaca
catacggatgttgtggcaatcgatgaagtgcaattttttgacgaacatgtcgttgatgtt
gttcaacagctcgccgatgaaggataccgtgtcatcgtcgctgggttagatcaagatttt
cgcggcgaaccgttcggccctgtcccgacgttaatgtctatcgctgaatcggtgacaaag
ctacaagctgtttgtaccgtttgcggttcccctgcatcgcgcacacagcggctcattaat
gggcgtccagcatcttaccacgatcccgtcattttaatcggagccagtgaatcgtacgaa
ccacgatgccgccatcatcatgaagtgcctgatcatccaaagaaaaataaaacatgtaaa
gaaacggccactcgtccataa

DBGET integrated database retrieval system