KEGG   Agrobacterium sp. H13-3: AGROH133_04635Help
Entry
AGROH133_04635    CDS       T01432                                 

Gene name
sodF
Definition
(GenBank) Superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
agr  Agrobacterium sp. H13-3
Brite
Enzymes [BR:agr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AGROH133_04635 (sodF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
circular:825763..826365
Genome map
AA seq 200 aa AA seqDB search
MAFELPELPYDYDALAPYMSRETLEFHHDKHHKAYVDNGNKLAAEAGLSDLSLEEVVKKS
FGTNAGLFNNAAQHYNHVHFWKWLKKDGGGNKLPGKLEQAFASDLGGYDKFKADFIAAGT
TQFGSGWAWVSVKNGKLEISKTPNGENPLVHGAEPILGVDVWEHSYYIDYRNLRPKYLEA
FVDNLINWDYVLERYEAAFK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggccttcgaacttcctgaactcccctacgactacgacgcgcttgcaccatacatgtcg
cgcgagacgctcgagttccatcacgacaagcaccacaaggcttatgtcgacaacggcaac
aagttggcggcggaagccggtctttccgacctttcgcttgaggaagtcgtgaagaagtcc
tttggcaccaatgctggtctcttcaacaatgctgcccagcattacaaccacgtccatttc
tggaagtggctgaagaaggacggcggcggcaacaagctgccgggcaagctggaacaggca
ttcgcctccgatctcggcggttacgacaagttcaaggctgatttcatcgctgccggcacc
acgcagttcggctcgggctgggcatgggtttccgtcaagaacggcaagctcgaaatctcc
aagactccgaacggcgaaaacccgctggttcatggcgcagaaccgatcctcggcgtcgac
gtatgggaacactcctactacatcgactaccgcaacctgcgtccgaagtacctcgaagcc
ttcgtcgacaacctcatcaactgggactacgtcctggagcgttacgaagccgctttcaag
taa

DBGET integrated database retrieval system