KEGG   Agromyces aureus: ATC03_02560Help
Entry
ATC03_02560       CDS       T04413                                 

Definition
(GenBank) kynureninase
  KO
K01556  
kynureninase [EC:3.7.1.3]
Organism
agy  Agromyces aureus
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:agy00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    ATC03_02560
Enzymes [BR:agy01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     ATC03_02560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(599520..600812)
Genome map
AA seq 430 aa AA seqDB search
MSIAPAIPHVIDRATCTALDAADPLAGHRELFDLPEGVVYLDGNSLGALPRATAARVQRV
IAEEWGTGLIRSWNDAGWFTKPIDLGDRIAPLIGAAAGEVVLGDSTSGSLFQVAVAAARL
RPERRVIVSELGNFPTDLYVLESVQELVGEPGRPLERRLIGGDGIPGPTLADVLDDDVAV
VVLTHVNYRTGRMYDMNEVTRQVQAAGAIMVWDLCHSVGAVPVDLNGAGADFAIGCTYKY
LNGGPGSPSFIWAAERHHPEARPAITAWHGHAKPFDFDVEYAPAPGITRFRVGTPQLLSV
AALEASLDIWRDVDLELLREKSLRLTELFISLVDSRLAPWGIEVVTPRQSARRGSQVALR
AGGADGYAVMQALIERGVIGDFRAPDLMRFGFTPLYVSHADVWDAVATLEDILSTEVWRD
SRFARRGAVT
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcgcccccgccatcccgcacgtgatcgaccgcgcgacctgcacggccctcgat
gccgccgacccgctcgcgggccaccgcgagctgttcgacctcccggagggcgtcgtgtac
ctcgacggcaactcgctcggcgccctgccccgcgcgacggccgcgcgcgtgcagcgcgtg
atcgccgaggagtggggcaccgggctcatccgcagctggaacgacgcgggctggttcacg
aagccgatcgacctcggcgatcgcatcgcgccgctcatcggcgcggccgcgggcgaggtc
gtgctcggcgactcgacgtcgggcagcctcttccaggtcgcggtcgccgcggctcgcctg
cgtccggagcgccgcgtgatcgtctcggagctcggcaacttcccgaccgatctctacgtg
ctcgaatcggtgcaggagctggtcggcgagcccggtcggccgctcgaacgccggctcatc
ggcggcgacgggattcctggcccgaccctcgccgacgtgctcgacgacgacgtcgcggtc
gtcgtgctcacccacgtgaactaccgcacggggcgcatgtacgacatgaacgaggtgacg
cgtcaggtgcaggcggccggcgcgatcatggtgtgggacctctgccacagcgtcggcgcc
gtgcccgtcgacctcaacggcgccggagcggacttcgcgatcggctgcacctacaagtac
ctcaacggcggcccgggctcgccgtcgttcatctgggcggccgagcggcaccaccccgag
gcccgccccgcgatcacggcctggcacgggcacgcgaagccgttcgacttcgacgtggag
tatgcgccggcgcccggcatcacgcgcttccgggtcggcacgccgcagctgctgtccgtc
gccgcgctcgaggcgagcctcgacatctggcgcgacgtcgacctggagctgctgcgggag
aagagcctccggctcaccgagctcttcatctcgctcgtcgactcgcggctggcgccgtgg
ggcatcgaggtcgtcacgccgcggcagtcggctcggcgaggcagccaggtggcccttcgc
gccggcggcgccgacggctacgcggtcatgcaggcgctcatcgagcgaggggtcatcggc
gacttccgcgcgcccgacctgatgcgcttcggcttcacgccgctctacgtctcgcacgcc
gacgtgtgggacgccgtggcgacgctcgaggacatcctctcgaccgaggtctggcgcgac
tcgcgattcgcacgccgcggcgccgtgacctga

DBGET integrated database retrieval system