KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_1712Help
Entry
AHA_1712          CDS       T00424                                 

Definition
(RefSeq) glutathione S-transferase
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Brite
Enzymes [BR:aha01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     AHA_1712
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1874693..1875355
Genome map
AA seq 220 aa AA seqDB search
MIDFYTAATPNGFKVAIALEELGLPYRVIPLDLSALDQKKPEFLAINPNGRIPAIVDRDN
GDFAVFESGAILLYLAEKAGKLLPADPKRRSQAIQWLMFQMGGVGPMMGQANVFYRYFPE
KIPAAIERYQKEGRRLFEVLDSHLAHHEYLADEYSIADIATWPWVRIHDWSGISIEGLPH
LQAWMDRMAEKPACQKGITIPPRNEKPEDLVKQAQQMVTR
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatttttacaccgccgctacgcccaatggcttcaaggtggcgattgccctggaa
gagctgggcttgccctatcgggtgatcccgctcgatctgtcggcgctggatcagaagaag
cccgagtttctggccatcaaccccaacggccgtatcccggccatcgtcgatcgggataat
ggtgacttcgccgtgttcgagtccggcgccatcctcctctatttggcggagaaggcgggc
aagttgctgccggcagatcccaaacgccgctcccaggccatccagtggttgatgttccag
atgggcggggtcggtcccatgatggggcaggccaacgtcttctatcgctacttcccggag
aagatcccggccgccatcgagcgctaccagaaggaggggcgccgtctgttcgaggtgctc
gacagccatctggcccatcacgaatatctggccgacgagtacagcatcgccgacatcgct
acctggccctgggtgcgcattcatgactggagtggcatctccattgaggggttgccgcat
ctgcaagcctggatggaccggatggcagagaagcccgcctgccagaaggggatcaccata
ccgccgcgcaacgagaagccggaggatctggtcaaacaggcccagcagatggtaacgcgt
tga

DBGET integrated database retrieval system