KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_2627Help
Entry
AHA_2627          CDS       T00424                                 

Definition
(RefSeq) aminotransferase
  KO
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aha00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AHA_2627
   00290 Valine, leucine and isoleucine biosynthesis
    AHA_2627
   00220 Arginine biosynthesis
    AHA_2627
Enzymes [BR:aha01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     AHA_2627
    2.6.1.66  valine---pyruvate transaminase
     AHA_2627
Amino acid related enzymes [BR:aha01007]
 Aminotransferase (transaminase)
  Class I
   AHA_2627
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2928558..2929772
Genome map
AA seq 404 aa AA seqDB search
MFTIDKSHKLDDVCYDIRGPVHKEARRLEDEGHRIIKLNIGNPAPFGFDAPEEIIKDVIL
NMPLSQGYCDSKGLFSARKAVMQYYQQKGMRKVDIDDIYIGNGASELIVMAMQALLNNGD
EMLVPSPDYPLWTAAVTLSGGHAVHYRCDEGADWYPDLDDIRARITPRTRGLVLINPNNP
TGAVYGSEFLLEVIEIARQHNLIIFADEIYDKILYDDISHTSVCTLCDDVMVVTFNGLSK
AYRACGFRQGWMVITGPKGRAKGYIEGLEMLASMRLCANVPMQHAIQTALGGYQSINELI
LPGGRLRRQRDKAWELLNDIPGVSCVKPKGALYMFPRLDPKVYDIRDDQKMVFDLLQQEK
LLLVQGTGFNWPAPDHFRLVFLPREEELEEAIGRLARFLKGYKQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgttcactatcgacaagtcgcacaagctcgacgatgtctgctatgacatccgcggcccg
gtgcataaagaagctcgccgtctcgaagacgaaggccaccgcatcatcaagctcaacatc
ggcaacccggccccgttcggtttcgatgcgccggaagagatcatcaaggatgtgatcctc
aacatgccgctcagccagggctactgcgactccaaggggctgttctcggcccgcaaggcg
gtgatgcagtactaccagcaaaaagggatgcgcaaggtcgacatcgacgacatctacatc
ggcaacggtgccagcgagctcatcgtgatggcgatgcaggcgctgctcaacaacggcgac
gagatgctggtgccctcccccgactatccgctctggacggcggcagtgaccctctccggc
ggccatgcggtgcactatcgctgcgacgaaggggccgactggtatccggatctcgacgac
atccgcgcccgcatcaccccgcgcacccgcggcctggtgctgatcaaccccaacaacccg
actggcgccgtctacggcagcgagttcctgctggaagtgatcgagatcgcccgccagcac
aacctcatcatcttcgccgacgagatctacgacaagatcctctacgacgacatctcccac
accagcgtctgcaccctgtgcgacgatgtgatggtggtgaccttcaacggcctctccaag
gcctaccgcgcctgtggcttccgtcagggctggatggtcatcaccggtcccaagggccgt
gccaagggctacatcgaggggctggagatgctggcctccatgcggctctgtgccaacgtg
ccgatgcagcacgccatccagaccgccctgggtggctaccagagcatcaacgagctgatc
ctgccgggcggccgcctgcgccgccagcgcgacaaggcgtgggagctgctcaacgacatt
ccgggggtctcctgcgtcaagcccaagggggcgctctacatgttcccgcgcctcgacccc
aaggtgtacgacatccgcgacgaccagaagatggtgttcgatctgctgcagcaggaaaaa
ttgctgctggtgcagggcaccggcttcaactggccggcaccggatcacttccggctggtg
tttctgccccgggaagaggagctggaagaagccatcggccgtctcgcccgcttcctcaag
ggctacaagcagtaa

DBGET integrated database retrieval system