KEGG   Aeromonas hydrophila YL17: AI20_04420Help
Entry
AI20_04420        CDS       T03186                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
ahd  Aeromonas hydrophila YL17
Pathway
ahd00250  Alanine, aspartate and glutamate metabolism
ahd00280  Valine, leucine and isoleucine degradation
ahd00410  beta-Alanine metabolism
ahd00640  Propanoate metabolism
ahd00650  Butanoate metabolism
ahd01100  Metabolic pathways
ahd01120  Microbial metabolism in diverse environments
Module
ahd_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ahd00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AI20_04420
   00650 Butanoate metabolism
    AI20_04420
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AI20_04420
   00280 Valine, leucine and isoleucine degradation
    AI20_04420
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AI20_04420
Enzymes [BR:ahd01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AI20_04420
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     AI20_04420
Amino acid related enzymes [BR:ahd01007]
 Aminotransferase (transaminase)
  Class III
   AI20_04420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AHV34466
LinkDB All DBs
Position
4451442..4452731
Genome map
AA seq 429 aa AA seqDB search
MSQSASNKAWQARREAAVVNGVGTLLPVFIERAQNAELWDVEGNRYIDFASGIAVLNTGH
NHPKVVAAVRAQLEKFSHTCFQVTPYPGYIELAEKLNALVPGPTPKRTLFLSTGAEAVEN
AIKIARAHTGRSGTIAFKGGFHGRTMMGMALTGKVVPYKTGFGPFPGEVYHLPFPSDYLG
VSEADALAALDLCFSSDIEPTRVAAIIIEPVQGEGGFYPASASFMQRLRQLCDQHGILLI
CDEIQSGFCRTGKTFATEYSGIEPDIMTLAKSLAGGFPLSAVVGKAEVMNAAKPGGLGGT
YAGSPIACAAALAVLEVIEEEQLNQQAQAQGEQIKARLQQLAERFDCIGDIRGPGAMVAM
ELVKQRDANRPDAELTKRLVAEAGKRGLVLLACGVRANVIRFLAPLTASPAIIEEGLTLL
EQALQAAHA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagtcagcatcaaacaaggcgtggcaagcgcgccgcgaagccgccgtggtcaac
ggcgtcggcaccctgctgccggtgtttatcgagcgggcgcaaaacgccgagctgtgggat
gtggagggcaaccgctacatcgattttgcctccggcatcgccgtgctcaacaccggccac
aaccacccgaaagtggtggctgcggtgcgcgcgcagctggagaagttcagccacacctgc
ttccaggtcaccccctaccccggctatatcgagctggcggaaaaactgaatgccctggtg
cccggccctaccccgaaacgcaccctgtttctctccaccggtgccgaggcggtagagaac
gccatcaagatcgcccgcgcccacaccggccgcagcggcaccatcgccttcaaggggggc
tttcacggccgcaccatgatggggatggcgctcaccggcaaggtggtgccctacaagacc
ggcttcggccccttcccgggggaggtctatcacctgcccttcccgagcgactatctggga
gtgagtgaggccgatgccctggctgcgctggatctctgcttcagctcggatatcgaaccg
acccgggtggccgccatcatcatcgaaccggtgcagggtgaagggggcttctaccccgcc
tccgccagcttcatgcagcgcctgcgccagctgtgcgatcagcacggcatcctgctcatc
tgcgacgagatccagagcggtttctgtcgcaccggcaagaccttcgccaccgaatacagc
ggcatcgagccggacatcatgacgctcgccaagagcctggccggcggcttcccgctctcc
gccgtggtaggcaaggcggaggtgatgaacgccgccaagccgggtggtctgggcggcacc
tacgccggttcccccatcgcctgcgccgccgccctggcagtgctggaggtgatcgaagag
gagcagctcaaccagcaggctcaggcccagggcgagcagatcaaggcgcgcctgcagcag
ctggccgagcgttttgactgcatcggcgacatccgtggccccggcgccatggtggccatg
gagctggtcaagcagcgcgacgcaaaccggccggatgccgagctcaccaagcgactggtg
gccgaggcgggcaaacgcgggctggtgctgctggcctgcggcgtgcgcgccaacgtcatc
cgcttcctggcgccgctgacggcctcgccggccatcatcgaggaggggctgaccctgctt
gaacaggccctgcaggcggctcacgcctga

DBGET integrated database retrieval system