KEGG   Aeromonas hydrophila YL17: AI20_08190Help
Entry
AI20_08190        CDS       T03186                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
ahd  Aeromonas hydrophila YL17
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ahd00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AI20_08190
Enzymes [BR:ahd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AI20_08190
Transporters [BR:ahd02000]
 Other Transporters
  Pores ion channels [TC:1]
   AI20_08190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
3549177..3549812
Genome map
AA seq 211 aa AA seqDB search
MITLYGTPVSRALRVSWLLEELDVAWQFQFLDFAKGENRSDWFLTLNPSGKMPVLKDGEF
VLTESAAIMQYLAEVYGPNWLPARGTQASALHAQWVSFITCELEQPLWTIGKHRFALPEA
QRLPAIFPTAKWEFDKAAAIAESWVPEQGYLLGEQVTIADLLLAHTLMWATRFEQTIPPK
LAAYRDRLAKRPALQAVLAKTQAIADAAQAG
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccttatatggcacccccgtcagccgtgccctgcgcgtatcctggttactggaa
gagctggacgtggcatggcagttccagtttctcgacttcgccaagggcgagaaccgcagc
gactggtttttgaccctcaacccgagcggcaagatgccggtgctcaaggacggggagttc
gtgctgaccgaatccgccgccatcatgcagtacctggccgaggtgtatggcccgaactgg
ctgccggccagagggacccaggcctcggcactgcacgcccagtgggtcagcttcatcacc
tgtgaactggagcagccgctgtggaccatcggcaaacaccgcttcgccctgcccgaggcc
cagcgcctgccggccatcttccccactgccaagtgggagtttgacaaggcggcggccatc
gccgaatcctgggtgcccgagcagggttacctgctgggtgagcaggtaaccattgcggat
ctgctgctggcccataccctgatgtgggccacccgcttcgagcagaccattccgcccaag
ctggcggcctatcgggatcgtctggccaagcgccccgccctgcaggcggtgctcgccaag
acccaggccatcgccgacgctgcccaggcaggctga

DBGET integrated database retrieval system