KEGG   Arcanobacterium haemolyticum: Arch_0026Help
Entry
Arch_0026         CDS       T01242                                 

Definition
(GenBank) Exo-alpha-sialidase
Organism
ahe  Arcanobacterium haemolyticum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
40803..43460
Genome map
AA seq 885 aa AA seqDB search
MKYQHIRKAVLAGIASSTLVFSGLAMAPLGHAADAEAPHPEAATAAPASEETLGTAEAVN
LPAKEGLKPQPSAQIGLGFSDITEPIAIQENVEGINYRIPAITATPKGDLIAAFDERPLS
SEKASWTQLFGRRHWKNGGDSPNPNSIVQYRSVDNGKSWQKENNICDGTVTSDMEKISGC
SDPSYVVDWDTGKIFNFHVRSYRAGLHESKSGNDAASHDVVQVEISESIDDGKTWNSRII
TKNVTPDGNVKWRFATSGQGIQLTHRSHKGWLIQQFTLGQGEPGTKQEAFSFISKDGGTT
WNAGDAVGADMDENKVVELSDGRLLLTSRHKNGKRLGKRIQAFSKNGGFSWERESVMPDV
VDHGTNGQILKVFPGIPSEDPRSKVLLFANSTSNIGDNDRHNGTVWLSCNDGENWTSKEF
NKGSTGYVTITTQHDGRIGMLSEDGKNGKKEHGIYYRSFGLDWVGTCPGVKEAIELDKAK
ADLEKAKSEKAKLEKQVAKQAEGLEKLQQNLEKAENKAVALQENVDKLALDIKAKTEALD
ELKADSETTRAEKARLQKEFDSINAKLEVAKAEKQRVASDLAVKEAKLTESEKQKAAAEK
KVAEQHKQIEDLNAKVKKAESERDQATESAKNLEEKAKEDAKSIEGLEGNLSEFADENDA
LRSKINKLTKENTDLKAQLEKVKKELEEAKKVPQDDVKPKPAPQPAPQPEPAPEVKGVTP
HVDGITPDASDPAACMVTPYVKVSPVEGVTYEVTVDGQVISPTKDDLFTYEYLYGKTVKV
NAILKDGFTLAKGAKTTWSWTAPNRDELKCDTPARPVDPTPVPPGEDPSPQVKDVPQDKV
DTKITADTKAESKGLAKTGLSLGIITVLAALCIIGGTTATRRRHD
NT seq 2658 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatcagcacatccgcaaggccgttctggccggaatcgcatctagtacgctcgtg
ttttcgggcttggcgatggcgccgctcggccacgcagccgacgcggaagcgccgcatcca
gaagctgctactgctgctccggcatctgaagaaacactaggtactgcagaggcagtcaat
ctgcctgcgaaggaaggcctgaagccgcagccttcggcgcagataggccttggcttcagt
gatattacagaacctattgcgattcaagaaaatgttgaggggattaattatcgaattcct
gcgattacggccacacccaaaggtgatcttattgctgctttcgacgaacgtcctttgagt
tctgaaaaagcttcatggactcaattgtttggacgtcgtcattggaaaaatggtggagac
tcaccaaatcctaattctattgtgcaatatcgttctgttgataatggaaaatcttggcaa
aaagaaaataatatctgtgacggtactgttacttcagatatggaaaaaattagtggatgt
tctgatccctcttatgttgttgactgggatacaggcaaaatatttaattttcacgtgcgt
tcttatcgtgcgggcttacatgaatctaagagtggtaatgatgcagcaagccatgatgta
gtgcaagttgaaatttctgaatcaattgatgatggaaagacttggaattctcgaattata
accaaaaatgtaactcctgatgggaatgtcaagtggagatttgcgacatctggccagggg
attcaattgactcatcgcagtcataaaggttggttaatacagcaattcacccttggacaa
ggagagccggggacaaaacaagaagcattttcttttatttctaaagatggcggaaccacc
tggaacgcgggtgatgctgtcggcgcggatatggatgaaaataaagtagtcgaattgtca
gatgggcgtttattgctcacttcacgccataaaaatgggaaaagacttggtaagcgtata
caagcattttctaaaaatggtggtttctcatgggagagagaatctgtgatgccagatgtt
gttgatcatggaacaaatggtcaaattctaaaggtattcccaggaattccatctgaagat
ccaagatctaaagttctactatttgctaattccacgagcaatataggagataatgaccgt
cataatgggactgtatggttgtcttgtaatgatggggaaaattggacgtcaaaagagttt
aataaaggatcgacaggatacgttactattactacccagcatgatgggcgtatagggatg
ctttctgaagatggaaagaatggtaaaaaagagcatggtatttactaccgtagctttggc
ctcgactgggttggcacctgccctggcgtaaaagaagcaattgaactcgataaggctaaa
gctgatcttgaaaaggctaaatctgagaaggctaagctagaaaagcaggtagccaagcaa
gcagaagggcttgagaagttacagcaaaaccttgaaaaagcagagaataaggctgttgca
ctacaagaaaatgtagataagctagctctggatatcaaggctaaaactgaagcgttagat
gaattgaaggctgattcggaaactacacgcgctgaaaaagcacgcttgcagaaagaattt
gactctatcaacgcgaaactggaggttgctaaggctgaaaaacaacgcgtagcctcggat
cttgctgtcaaagaagctaagctcaccgaatccgaaaagcagaaggctgccgccgaaaag
aaggttgccgaacagcacaagcagatcgaagatctcaacgccaaggtgaagaaggctgaa
tctgaacgcgatcaagccactgaatccgccaagaatttagaggagaaagccaaagaagac
gccaagtccatcgaaggactagaaggtaatctttctgaatttgccgatgaaaacgatgct
cttcgttccaagataaacaaactcaccaaggaaaacactgacctcaaggctcaacttgag
aaggttaagaaggaactggaagaggctaagaaggttccacaggatgatgtaaagccaaag
ccggcaccgcagccggcaccgcagcctgagccggctcctgaggttaagggtgtcaccccg
cacgttgatggtattactcctgacgcgtctgatccagcagcatgtatggtcactccatat
gtcaaggtcagtcctgtagaaggtgtcacctatgaggttactgttgacggtcaggtgatc
agcccaaccaaggatgatctctttacttatgaatacctctacgggaagaccgtgaaggtt
aacgccattctcaaggacggattcactttagctaagggggcgaagaccacctggtcgtgg
actgctccaaatcgtgatgaactcaagtgtgacacgccagcacgccctgttgatccaaca
ccagttccgccaggcgaggatcctagcccgcaggtgaaggatgttccacaggacaaggta
gacaccaagatcacggcagacaccaaggctgaatctaaaggtctggccaagactggcctg
tccctgggcatcatcaccgtcctggcagccctctgcatcatcggaggaaccacagccacc
cgccgccgtcacgactga

DBGET integrated database retrieval system