KEGG   Arcanobacterium haemolyticum: Arch_1299Help
Entry
Arch_1299         CDS       T01242                                 

Definition
(GenBank) LPXTG-motif cell wall anchor domain protein
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
ahe  Arcanobacterium haemolyticum
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ahe00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Arch_1299
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Arch_1299
Enzymes [BR:ahe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     Arch_1299
Bacterial toxins [BR:ahe02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   Arch_1299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(1442636..1445209)
Genome map
AA seq 857 aa AA seqDB search
MRKFTSRLVAGIATMGLLIAPALPASASSEVINKRTLVNHAKTVGDAGTAYLAVDNGPED
DVVRVGETISFESRFQSGLSEIVYVKATSEALGDTQADKCSWRGVPYNSGAQLRQIPAKD
GYWCVQKPSYKVKEADLEHPTKTFDITYNVYKDANASGKPFSTLTVKKTVKIQKAIENPG
EKDGPKDVLLAKANDFDFPVHRIPALAKAPNGNLLAAWDGRPAVYSNNDSPNPNTILLRI
SKDNGETWEPVQKIASGQLRDKASGKKQIGYSDPSFVVDNVSGKVFAFFVKSYDQGIAGS
RSGVDPEDPNVIHAVYVVSENNGESWSAPKDVTGILAEGYKQHARFATSGAGIQLKYGDH
PGRLIQQYLVVNNGQDGNWGSGEHQAVSLYSDDNGKTWHSGKPVGTTMDENKVVELSDGK
VLLSSRQFHHRGGRHYAISSDGGINYQMDYTNDNRLADPQNNASIIRAFPEAKKGSALAK
VLLSSHANSRKHYDRVNGTISYSLDDGATWTNGSVFKPGKMQYSVMTALGNDAYGILYEG
NDSTIVYKKVDLNWISPELAKYAEDHKADLGNADSEAAEKIKKLEDEIADLKAKLEAANQ
AKDEAEKAAKKAEEEKRDADREKVKAETAKREVEAKLKKAEGDKADLEKRVAELEGDIAK
AEEAKKAADKAVEEANAAKKKAEEEAAELKAKNAELEKKLKEAGKAEIPLVPLTPAEPTP
APEPQPAPAISMVSDKVAVGSQVVFTGTGFTPDAKVKVAVHSTAVELGEYVADKDGKITV
TWTVPAGFELGAHKVIFTAGDKTVEKSFTVVAPEKPVPTKPAAPGLAKTGVTLGLVAGLA
TLSIMAGVVAVRRRHEV
NT seq 2574 nt NT seq  +upstreamnt  +downstreamnt
atgaggaagtttacctctcggctcgttgcgggtatcgcaacaatgggcctcttgatagcg
ccagcacttccggcaagtgcgtcaagcgaagttattaataagcgaacattggttaaccat
gccaaaacagtgggagatgctggaactgcttatcttgctgttgataatggtccagaagat
gacgtagtgagagtcggagaaacgatttctttcgaaagtcgtttccaatctggtctttcg
gaaattgtatatgttaaagcaacctccgaagctctaggtgatactcaagcggataaatgc
agctggcgcggtgttccttacaatagtggagctcaattgcggcaaatccctgcgaaagat
ggatattggtgcgtgcaaaaaccttcatataaggtaaaagaagccgatcttgagcatcct
acgaagacttttgatataacctataatgtttataaggatgctaatgctagtggtaaacct
ttctcgactttgacagtcaagaagacggtaaagattcagaaagctattgagaatcctggg
gaaaaagatgggcctaaggatgtgttacttgcaaaagccaacgattttgacttcccagtg
catcgcattccagctttagcgaaggcgccgaatggaaatcttctagcagcatgggatggt
cgtccagctgtttattctaacaatgattcgccaaatccaaataccattcttttacgtatc
tcaaaggataacggtgaaacatgggagcctgtccaaaaaattgcttcagggcagcttcgg
gacaaggcatctggcaaaaagcagattgggtattcggatccgtcattcgtagtagacaat
gtttctggaaaggtctttgcattttttgtgaagagctatgatcaaggaatcgcaggttct
cgtagcggagttgatcctgaagatcctaatgttattcatgcagtttatgtagtttcagag
aataatggagaatcttggtctgctcctaaggatgtgacaggaatcctagctgaaggctat
aagcaacatgcacgttttgctacttcgggtgcaggtatccagctcaagtatggtgatcat
ccgggacgtttaatccagcaatatctagttgtcaataacggacaagacggtaactggggc
agtggagagcatcaagcagtttcgctttattccgatgacaatggaaaaacttggcattca
ggtaaacccgttggcacaacaatggatgagaacaaggttgttgaattgtcggacggtaag
gttcttttgagctctcgtcagttccatcaccgaggcggacggcattatgctatttcttca
gatggcggaattaattaccagatggattatacaaatgataatcgcttagcagatccacaa
aacaatgcgtcaattattcgtgcgttcccagaagccaagaagggaagtgctttagctaag
gtacttctttcgtcacacgcaaatagtcgaaaacactatgaccgggtaaacggaaccatc
agttacagccttgatgacggcgcaacgtggacaaacggtagtgtatttaaacctggaaag
atgcagtattccgtcatgaccgctcttggcaatgatgcgtacggaattctatatgaaggt
aacgactccactatcgtctacaagaaggttgacctgaactggatctctccagaattggcc
aagtatgccgaagatcacaaggcagatctaggaaacgctgattctgaagctgctgagaag
atcaagaaacttgaagacgaaatcgcagatcttaaggcaaagctagaagctgctaaccaa
gccaaggatgaggcggaaaaggctgcaaagaaagctgaggaagaaaagcgtgacgctgac
cgggagaaggttaaggctgaaactgcaaagcgtgaagtagaagctaagctcaagaaggct
gaaggtgacaaagccgatctcgagaagcgcgtagcagagctcgaaggagatatcgccaag
gctgaagaagctaagaaggcagctgacaaggctgttgaggaagcaaacgccgccaagaag
aaagcagaagaggaagctgctgaactcaaggcaaagaatgctgaactcgaaaagaagctg
aaggaagctggtaaggctgaaattccgctggttccattaacaccagcggagccaacaccg
gctcctgaacctcagccagccccagccatttccatggtatctgacaaggttgctgttggc
agccaagtagtcttcaccggaaccggttttacgccagacgctaaggttaaagtcgcagtt
cactccacggctgtagagctcggcgaatacgtagctgacaaggatggcaagatcacggtt
acgtggaccgtcccagccggattcgaactcggcgctcacaaggttatcttcactgcaggt
gacaagaccgttgagaagtccttcaccgtggttgctccagagaaaccagttccaacgaag
ccagctgctcctggcttggctaaaaccggtgtcacccttggcctcgtggctggcctcgca
acactgtccatcatggcaggcgttgtggctgttcgacgtcgtcacgaagtctga

DBGET integrated database retrieval system