KEGG   Aeromonas hydrophila AL06-06: RY45_09355Help
Entry
RY45_09355        CDS       T03748                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
ahh  Aeromonas hydrophila AL06-06
Brite
Enzymes [BR:ahh01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     RY45_09355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3 Glutaredoxin2_C
Motif
Other DBs
NCBI-ProteinID: AJQ54280
LinkDB All DBs
Position
2016512..2017174
Genome map
AA seq 220 aa AA seqDB search
MIDFYTAATPNGFKVAIALEELGLPYRVIPLDLSALDQKKPEFLAINPNGRIPAIVDRDN
GDFAVFESGAILLYLAEKAGKLLPADPKRRSQAIQWLMFQMGGVGPMMGQANVFYRYFPE
KIPAAIERYQKEGRRLFEVLDSHLAHHEYLADEYSIADIATWPWVRIYDWSGISIEGLPH
LQAWMDRMAEKPTCQKGITIPPRNEKPEDLVKQAQHMVTR
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacttttataccgccgctacgcccaacggcttcaaggtggcgattgccctggaa
gagctgggcttgccctatcgggtgatcccgctcgatctgtcggcgctggatcagaagaag
cccgagtttctggccatcaaccccaatggccgtattccggccatcgtcgatcgggataat
ggtgacttcgctgtattcgagtccggcgccatcctcctctatctggcggagaaggcgggc
aagctgctgccggcagatcccaagcgtcgctcccaggccatccagtggctgatgttccag
atgggcggggtcggtcccatgatggggcaggccaacgtcttctatcgctacttcccggag
aagatcccggccgccatcgagcgctatcagaaggagggacgtcgtctgttcgaggtgctc
gacagccacctggctcatcacgaatatctggccgatgagtacagcatcgccgacatcgcc
acctggccctgggtgcgaatttatgactggagtggcatctccatcgaggggttgccccat
ctgcaagcctggatggaccggatggcagaaaagcccacctgccagaaggggatcaccata
ccgccgcgcaacgagaagccggaggatctggtcaaacaggcccagcatatggtaacgcgt
tga

DBGET integrated database retrieval system