KEGG   Aeromonas hydrophila AL06-06: RY45_15480Help
Entry
RY45_15480        CDS       T03748                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
ahh  Aeromonas hydrophila AL06-06
Pathway
ahh00250  Alanine, aspartate and glutamate metabolism
ahh00280  Valine, leucine and isoleucine degradation
ahh00410  beta-Alanine metabolism
ahh00640  Propanoate metabolism
ahh00650  Butanoate metabolism
ahh01100  Metabolic pathways
ahh01120  Microbial metabolism in diverse environments
Module
ahh_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ahh00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RY45_15480
   00650 Butanoate metabolism
    RY45_15480
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RY45_15480
   00280 Valine, leucine and isoleucine degradation
    RY45_15480
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RY45_15480
Enzymes [BR:ahh01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     RY45_15480
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     RY45_15480
Amino acid related enzymes [BR:ahh01007]
 Aminotransferase (transaminase)
  Class III
   RY45_15480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AJQ55416
LinkDB All DBs
Position
3445437..3446726
Genome map
AA seq 429 aa AA seqDB search
MSQSASNKAWQARREAAVVNGVGTLLPVFIDRAQNAELWDVEGNRYIDFASGIAVLNTGH
NHPKVVAAVRAQLEKFSHTCFQVTPYPGYIELAEKLNALVPGPTPKRTLFLSTGAEAVEN
AIKIARAHTGRSGTIAFKGGFHGRTMMGMALTGKVVPYKTGFGPFPGEVYHLPFPSDYLG
VSEADALAALDLCFSSDIEPTRVAAIIIEPVQGEGGFYPASTSFMQRLRQLCDQHGILLI
CDEIQSGFCRTGKTFATEYAGIEPDIMTLAKSLAGGFPLSAVVGKAEVMNAAKPGGLGGT
YAGSPIACAAALAVLEVIEEERLNQRAQAQGEQIKARLQRLAERFDCIGDIRGPGAMVAM
ELVKQRDAARPDADLTKRLVAEAGKRGLVLLACGVRANVIRFLAPLTASPALIDEGLDLL
EQALLAAQG
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagtcagcatcaaacaaggcgtggcaagcgcgccgcgaagcggccgtagtcaac
ggcgtcggcaccctgctgccggtgtttatcgatcgggcacaaaatgccgagctgtgggat
gtggagggcaaccgctacatcgattttgcttccggcatcgccgtgctcaacaccggccac
aaccacccgaaagtggtggcggcggtgcgcgcgcagctggaaaaattcagccacacctgc
ttccaggtcaccccctaccccggctatatcgagctggcggaaaaattgaatgccctggtg
cccggtcccaccccgaagcgcaccctgtttctctccaccggcgccgaggcggtggagaac
gccatcaagatcgcccgtgcccacaccggccgcagcggcaccatcgccttcaaggggggc
tttcacggccgcaccatgatggggatggcgctcaccggcaaggtggtgccctacaagacc
ggcttcggtcccttcccgggagaggtctatcacctgcccttcccgagcgactacctgggg
gtgagcgaggccgatgcgctggccgcgctggatctctgcttcagttcggatatcgagcca
acccgggtcgccgccatcatcatcgagccggtgcagggggaagggggcttctaccccgcc
tccaccagcttcatgcagcgcctgcgccagctgtgcgatcagcacggcatcctgctcatc
tgcgacgagatccagagcggtttctgtcgcaccggcaagaccttcgccaccgaatatgcc
ggcatcgagccggacatcatgaccctggccaagagcctggctggcggcttcccgctctcc
gccgtggtgggcaaggcggaggtgatgaacgccgccaagccgggtggtctgggcggcacc
tatgccggctcccccatcgcctgcgccgccgccctggcggtgctggaggtgatcgaagag
gagcggctcaaccaacgggcccaggctcagggcgagcagatcaaggcgcgcctgcagcgg
ctggcggagcgttttgactgcatcggcgacatccgcggccccggcgccatggtggccatg
gagctggtcaagcagcgcgatgcggccagaccggatgccgacctcaccaagcggctggtg
gccgaggcgggcaagcgtgggctggtgctgctggcctgcggcgtgcgcgccaacgtcatc
cgcttcctggcgccgctgacggcctcgccggccctcatcgacgaggggctggatctgctc
gagcaggccctgctggcagcccagggctga

DBGET integrated database retrieval system