KEGG   Actinoalloteichus hymeniacidonis: TL08_10990Help
Entry
TL08_10990        CDS       T04472                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase family protein
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
ahm  Actinoalloteichus hymeniacidonis
Pathway
ahm00250  Alanine, aspartate and glutamate metabolism
ahm00410  beta-Alanine metabolism
ahm00640  Propanoate metabolism
ahm00650  Butanoate metabolism
ahm01100  Metabolic pathways
ahm01120  Microbial metabolism in diverse environments
Module
ahm_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ahm00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    TL08_10990
   00650 Butanoate metabolism
    TL08_10990
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TL08_10990
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TL08_10990
Enzymes [BR:ahm01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     TL08_10990
Amino acid related enzymes [BR:ahm01007]
 Aminotransferase (transaminase)
  Class III
   TL08_10990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AOS63012
UniProt: A0A1D8BW49
LinkDB All DBs
Position
2378401..2379684
Genome map
AA seq 427 aa AA seqDB search
MSTILQLGVIMAQLSPVLKQATPVQVTRGEGVYLYDQNDQRYLDFTAGIGVTSTGHCHPK
VVAAAQRQVATLIHGQYTTVMHQPLITLTERLGEVLPAGLDSLFYVNSGSEAVEAALRLA
RQSTGRQNAVVFQGSFHGRTFGAASLTTSGAKIRAGIGPLVPGVTVAPFPYAYRYGLSEQ
DAVAFALRELDYLFATASPAADIAAFFIEPVLGEGGYVPVPPAFLAGLRERADRHGILLV
LDEVQTGFGRTGRFWGHQHSEVEPDILITAKGLASGFPLSAIAASTELMSRALPGSQGGT
YGGNAVACAAAIATLEVIQEEGLVANAATTGEQLLAGARRIAADHSAIGDVRGLGLMVAS
EFVEPDGSPAPAAAARVHRAASDLGLLLLTCGPHGNVVRMIPPLIVDAEQIDQGLEIWSK
AVAVGLG
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
ttgtcgacaatcctacagttgggtgtgatcatggctcagttgtcgccggtgctcaagcag
gccactcccgtgcaggtcacccggggtgagggtgtctacctctacgatcagaacgaccag
cgctatctcgacttcaccgccgggatcggcgtcaccagcaccggacactgtcatccgaag
gtcgtcgcagcagctcaacgacaggtggccacgctgatccacggccagtacaccaccgtg
atgcaccagccgctgatcacgttgaccgagcgactcggcgaggtactgcccgccggactc
gactcgctgttctacgtcaactccgggagcgaggccgtcgaggcggcgctccgccttgcc
cggcagtccaccggcaggcagaacgcggtggtcttccaaggctccttccacggccggacc
ttcggcgcggcctcgctgacgacctccggggcgaagatccgagcgggcatcggcccgctg
gtccccggcgtgacggtggcacccttcccctacgcctaccgctacggactgtccgaacag
gacgcggtcgccttcgcactgcgcgagctcgactatctgttcgccaccgcgagccccgcc
gccgacatcgcggccttcttcatcgaaccggtgctcggcgagggcgggtacgttccggtg
ccaccggccttcctcgccggactccgcgagcgggccgatcgacacggcatcctgctggtc
ctcgacgaggtgcagaccggattcggccggaccggtcgattctgggggcaccagcactcc
gaggtcgagccggacatcctgatcacggcgaagggcttggcaagcggattccccttgtcg
gccatcgctgcgagcaccgagctgatgagcagggccctgcccggctcgcagggcggtacc
tacggcggcaacgcggtggcctgcgctgcggccatcgccaccctggaggtcatccaggag
gagggactcgtcgccaatgccgcgaccaccggcgagcagcttctggcgggtgcccgccgg
atcgccgcggaccattcggcgatcggcgatgtgcggggcctcggattgatggtcgccagc
gaattcgtcgaaccggacggttcccccgccccggcggccgcggccagggtgcatcgcgcc
gcatcggatctggggctgctgctgctcacctgcggtccgcacggcaacgtcgtgcggatg
atccccccgttgatcgtggatgcggagcagatcgaccagggcctggagatctggtcgaag
gcggtggccgtcggactgggctga

DBGET integrated database retrieval system