KEGG   Actinoalloteichus hymeniacidonis: TL08_25755Help
Entry
TL08_25755        CDS       T04472                                 

Definition
(GenBank) Kynureninase
  KO
K01556  
kynureninase [EC:3.7.1.3]
Organism
ahm  Actinoalloteichus hymeniacidonis
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ahm00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    TL08_25755
Enzymes [BR:ahm01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     TL08_25755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
6005119..6006354
Genome map
AA seq 411 aa AA seqDB search
MADLDGTTSSDLAALTARARQADAADPLAAVRDRFTLPDGLVYLDGNSLGALPTAVRPRI
DALLDQEWGRGLISSWWDADWWRAPQRVGDLIAPLLGAAEGQVVVGDSTSVNVFRAVVSA
WRLANADDPGRTEIVVDDTTFPTDGYLAASAARLLGASIRRRLLTESDAFDAHTAVVLAN
HVDYRTGRLWDLPEITARAHHAGARVVWDLSHSAGAMPIDLDRHGVDLAVGCGYKFLNGG
PGAPAYLYVRSELQDRLEQPLPGWSSHAEPFAMEAEYRPASGIVRARGGTPEILSLLALE
AALTVWEGVEITQVRAKSLALTDFFLDCVDALVEPGRFGCLTPRDDDRGSQVSLTASDAA
ELVPLLARHQVVGDHRPPDVLRFGFAPLYVGFAEVLRAAQVLAEVSRRPHH
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggctgatctggatggcacgacgagttccgacctcgccgcgttgaccgccagggcacgg
caggccgacgcagccgatccgctggccgccgttcgcgaccgattcacccttcccgatggc
ctcgtctatctggacggcaactcgctcggtgcgctgccgaccgcggtccgaccgcgtatc
gatgcattgctcgatcaggagtggggccgggggctcatctcctcgtggtgggacgccgat
tggtggcgggcaccgcaacgggtcggggatttgatcgcgccgttgctgggtgcggccgag
ggccaggtggtggtgggcgattccaccagcgtcaacgtgttccgcgcggtcgtctcggcc
tggcggttggccaatgccgacgatcccggacgcaccgagatcgtcgtcgacgacacgacc
ttccccaccgacggctatctcgcggcctccgccgcccgactactcggcgcctccatccga
cgacgactgctgaccgagtcggacgccttcgacgcgcacaccgccgtggtgctggccaat
cacgtcgattaccgcaccggccgactctgggatctgcccgagatcaccgcacgggcccac
cacgcgggggccagggtggtgtgggacctctcgcacagtgcgggtgcgatgccgatcgac
ctcgaccggcacggcgtggacctcgcggtgggctgcgggtacaagttcctcaacggcgga
ccgggagcgcctgcctacctctacgtgcggtcggagttgcaggaccggttggagcagccg
ctgcccggctggtcctcgcatgcggagccgttcgcgatggaggcggagtaccgcccggcg
tcgggcatcgtccgggccaggggcggcacccccgagatcctctcgctgctggccttggag
gccgcgctgacggtctgggagggcgtcgagataacgcaggtgcgagccaagagcctggcc
cttaccgacttcttcctggactgcgtcgacgccctcgtggaaccgggtcgcttcggctgt
ctcaccccccgcgacgacgatcggggcagccaggtgtccctgaccgcctcggatgccgcc
gagttggtgcccctgctcgcccgacaccaggtcgtcggggatcaccgaccaccggatgtt
ctgcggttcgggttcgccccgttgtatgtcggattcgccgaggtgctgcgggcggctcag
gtgttggccgaggtgtcccggcggccacaccactga

DBGET integrated database retrieval system