KEGG   Acidianus hospitalis: Ahos_2286Help
Entry
Ahos_2286         CDS       T01493                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
aho  Acidianus hospitalis
Pathway
aho00620  Pyruvate metabolism
aho00680  Methane metabolism
aho00720  Carbon fixation pathways in prokaryotes
aho01100  Metabolic pathways
aho01120  Microbial metabolism in diverse environments
aho01200  Carbon metabolism
Module
aho_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:aho00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Ahos_2286
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Ahos_2286
   00680 Methane metabolism
    Ahos_2286
Enzymes [BR:aho01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Ahos_2286
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2 Cofac_haem_bdg
Motif
Other DBs
NCBI-ProteinID: AEE95157
UniProt: F4B9U1
LinkDB All DBs
Position
complement(2075688..2077217)
Genome map
AA seq 509 aa AA seqDB search
MRKIPKTMSTQHPDNARVPEWAKSEVIEGDDEVIEAYYSYMNLGIHEVMWDAEGKDVDTH
VVRKLLSSYAEYFKENIIGQDVFLTYRLPNPRIEGAERKVFAETMESIPVAYDLAEKFYG
KKVIPVFEVILPFTTDYQELVSVAKYYEKAVAGEEDIELFEGIHVRDLVGEIYPKRVEVI
PLIEDKDSLLRIREIVGGYYKVIKPTYMRVFIARSDPAMNYGMLTAVLLAKFALSTLYKM
KNELGIEIFPIIGVGSLPFRGHLSPKNYENALKEYKGVYTFTIQSAFKYDYDEKEVKEAI
QKINENKVEEPKVFDEHEEGLLKKIVENYVSSYQPIIEALAPAINFIALNLPRRRARKLH
ISLFGYARSTGKVTLPRAISFVGAMYTLGIPPEIIGLSSLSKLSEEEWDFLKENYIMFNH
DLNESGKYVNLDTLEYLKEIWNIDDEVINKIKEDIKFAESIGIKIGGDDYESKKHVLLSS
LALLACKEKKYDEMKEYIKEMALIRKSLG
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagattcctaaaactatgtctactcaacatccagataatgctagagttccagaa
tgggcaaaaagtgaggtcatagaaggagatgatgaagtgatagaggcttactattcttat
atgaatttgggaattcacgaagtaatgtgggatgctgaagggaaggacgttgacactcat
gttgtgagaaaattactttcatcgtatgccgaatattttaaagagaatataataggtcaa
gacgtattcttaacttatagactaccaaatccaagaatcgaaggcgcagaaagaaaagtt
ttcgctgaaactatggaaagtattccagtagcttacgatctagctgagaaattttatggc
aaaaaagtaattccagtatttgaggtaattttaccttttactaccgattatcaagagcta
gtttctgttgcaaaatattatgaaaaagccgttgctggagaagaagatattgaactattt
gaaggaattcacgtaagggatcttgtaggcgagatatatccaaaaagagtagaagttata
cctttaattgaagacaaggactctttattaagaataagggaaatagtaggtgggtattat
aaagtaataaaaccaacttacatgagagttttcatagccagatcggatccggcaatgaat
tatgggatgctaactgctgtacttttggcaaaatttgcgctaagtaccctatataaaatg
aaaaatgagttgggaatagaaatattccctataataggcgtaggatctctaccttttaga
ggtcatcttagtcctaaaaattatgagaacgcattaaaagaatataaaggagtttatact
tttacaatccagtcagcctttaaatatgactatgatgagaaggaagtcaaagaggccatt
cagaaaattaatgagaacaaagtagaagagcctaaagtatttgatgaacacgaagagggt
ttattgaagaaaattgttgagaattacgtatcttcttatcagcctataatagaagctctt
gcaccagcaataaatttcattgcacttaacttgcccaggaggagagctagaaagttgcac
ataagcctatttggttacgctagaagtaccggaaaagtaacattacctagagcaattagc
tttgttggtgcaatgtacactctaggtattcctccagaaataattggattatcatcgctt
tcaaagttatcagaggaagaatgggatttcttaaaagagaattatataatgtttaatcat
gaccttaatgagagtgggaagtacgttaacttggacacactagagtatttaaaggaaata
tggaacatagatgacgaagttattaataaaataaaagaggacataaagtttgctgagagt
attggaataaaaattggaggtgatgattacgagtctaaaaaacacgtattattatcttct
ttagccttgctcgcttgtaaggaaaagaagtacgatgaaatgaaggagtatataaaagaa
atggcattaataagaaagtcacttggctaa

DBGET integrated database retrieval system