KEGG   Antarctobacter heliothermus: ANTHELSMS3_00665Help
Entry
ANTHELSMS3_00665  CDS       T04983                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
aht  Antarctobacter heliothermus
Brite
Translation factors [BR:aht03012]
 Eukaryotic Type
  Elongation factors
   ANTHELSMS3_00665
 Prokaryotic Type
   ANTHELSMS3_00665
Mitochondrial biogenesis [BR:aht03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    ANTHELSMS3_00665
Exosome [BR:aht04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   ANTHELSMS3_00665
  Exosomal proteins of breast cancer cells
   ANTHELSMS3_00665
  Exosomal proteins of colorectal cancer cells
   ANTHELSMS3_00665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(675021..676196)
Genome map
AA seq 391 aa AA seqDB search
MGKEKFERGKPHCNIGTIGHVDHGKTTLTAAITKYFGDFRAYDQIDGAPEEKARGITIST
AHVEYETDNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVNAADGPMPQTREHILLGRQ
VGIPAMVVFLNKVDQVDDEELLELVEMEVRELLSEYDYPGDDIPIIAGSALAAMEGRDPE
IGENKIRELMAAVDEYIPQPERAIDMPFLMPIEDVFSISGRGTVVTGRIERGVINVGDTI
EIVGIRDTSSTTCTGVEMFRKLLDRGEAGDNVGVLLRGIDREGVERGQVLCKPKSVNPHT
KFECEVYILTKEEGGRHTPFFKNYRPQFYFRTTDVTGTVELPDGTEMVMPGDNLKFNVEL
IAPIAMEDGLRFAIREGGRTVGSGVVSKIID
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaggaaaagtttgaacgcggcaagccgcactgcaacatcggcacgattggccac
gttgaccacggcaagacgacgctgacagcggcgatcaccaagtatttcggtgacttccgc
gcctacgaccagatcgacggcgcaccggaagaaaaagcccgcggcatcaccatctcgacc
gcacacgtcgagtatgaaaccgacaaccgccactacgcgcacgtcgactgccccggccac
gccgactacgtcaagaacatgatcaccggtgctgcgcagatggacggcgcgatcctggtc
gtgaacgccgccgacggcccgatgccgcaaacgcgtgagcacatcctgctgggccgccag
gtgggtatccccgccatggtcgtgttcctgaacaaagtcgaccaggtcgacgatgaggaa
ctgctcgagctggtggaaatggaagtccgcgagctgctgtccgaatacgactatccgggc
gacgacattccgatcatcgcgggctccgcgctggcggcgatggaaggccgcgatccggaa
atcggcgagaacaagatccgcgaactgatggcggccgtggatgagtacatcccgcagccc
gagcgcgcgatcgacatgccgttcctgatgccgatcgaagacgtgttctcgatctcgggt
cgtggtacggttgtgaccggccggatcgagcgtggcgtgatcaacgtgggcgataccatt
gaaatcgttggtatccgtgacacgtcctcgaccacctgtaccggtgtcgaaatgttccgc
aagctgctggatcgcggtgaagctggcgacaacgtcggcgtcctgctgcgcggcatcgac
cgcgaaggcgttgagcgcggccaggttctgtgcaagccgaagtcggtgaacccgcacacc
aagttcgagtgtgaggtctacatcctgaccaaggaagaaggcggtcgtcacacaccgttc
ttcaagaactaccgcccgcagttctacttccggaccaccgacgtgaccggtacggttgaa
ctgcccgacggcaccgaaatggtgatgccgggcgacaacctgaagttcaacgtcgagctg
atcgccccgatcgccatggaagacggcctgcgtttcgccatccgtgaaggcggccgcacc
gttggttccggcgtcgtgtcgaaaatcatcgactga

DBGET integrated database retrieval system