KEGG   Azospirillum humicireducens: A6A40_13890Help
Entry
A6A40_13890       CDS       T04409                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
ahu  Azospirillum humicireducens
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ahu00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    A6A40_13890
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    A6A40_13890
Enzymes [BR:ahu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     A6A40_13890
Peptidoglycan biosynthesis and degradation proteins [BR:ahu01011]
 Precursor biosynthesis
  Racemase
   A6A40_13890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2996969..2998099
Genome map
AA seq 376 aa AA seqDB search
MTRVTSDQTPRAGAILTVDVGAVVANWTQLRDRVAPAECSAVVKADAYGLGAARVVPALA
AAGCRTFVVAQLEEALAVRRALEPVAPEAQVFSLGGLPPGYEGEFIAGRILPVLNHLGEI
AAWRAFTASRGEVLPAVIHIDTGMNRLGLGPDELDELAGHPDWLEGINVRYWMTHLACAD
EFDNPMTGEQLERFRSALARLPKAKASFANSSGIFHGADHHFDLARPGCALYGVNPTPHL
PNPMRGTVRLDARLLQVRNCSAPMTVGYGAAHKVTGPARIATIGVGYADGYLRSLSGKGH
VFVDGVAAPIVGRISMDLITIDVTGLPENVAQAGRMVELIGPSRPVDTVAAEAGTIGYEV
LTSLGQRYHRVYVSGE
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
gtgaccagagtgaccagcgaccagaccccgcgcgccggcgcgatcctcaccgtggatgtc
ggcgccgtcgtcgccaactggacgcagctgcgcgaccgggtggccccggcggagtgttcc
gccgtggtcaaggccgacgcctatgggctgggggcggcgcgggtggtgccggccctggcc
gccgccggctgccggaccttcgtcgtcgcccagctggaggaggcgctggccgtccgccgc
gcgctggagcccgtggcgcccgaggcgcaggtcttctcgctgggcgggctgccgccgggt
tatgagggcgagttcatcgccgggcgcatcctgccggtgctgaaccatctgggcgagatc
gcggcgtggcgggccttcacggcctcgcgcggcgaggtgttgccggcggtgatccacatc
gacaccggcatgaaccggctggggctcggccccgacgagctggacgagctggccggccat
ccggactggctggagggcatcaacgtccgctattggatgacgcacctcgcctgcgccgac
gagttcgacaacccgatgaccggggagcagctggagcggttccgcagcgcgctcgcccgg
ctgccgaaggcgaaggccagcttcgccaattcgtcgggcatcttccacggcgcggaccat
cacttcgacctcgcccggccgggctgcgcgctctatggcgtgaacccgacgccgcatctg
cccaacccgatgcgcggcacggtgcggctggatgcgcggctcctgcaggtgcgcaactgc
tcggcaccgatgacggtcggctatggcgccgcccataaggtcaccgggccggcgcggatc
gccaccatcggcgtcggctatgccgacggctatctgcgctcgctgagcggcaaggggcat
gtcttcgtcgatggcgtcgccgcccccatcgtcgggcggatctcgatggacctcatcacc
atcgacgtgaccggcctgccggagaacgtggcgcaggccggccgcatggtcgagctgatc
ggccccagccgcccggtcgacacggtggcggcggaggccgggaccatcggctacgaagtg
ctgacctcgctcggccagcgctatcaccgggtttatgtgagcggagagtaa

DBGET integrated database retrieval system