KEGG   Aeromonas hydrophila ML09-119: AHML_11775Help
Entry
AHML_11775        CDS       T02683                                 

Definition
(GenBank) glutathione S-transferase domain-containing protein
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
ahy  Aeromonas hydrophila ML09-119
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ahy00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AHML_11775
Enzymes [BR:ahy01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AHML_11775
Transporters [BR:ahy02000]
 Other Transporters
  Pores ion channels [TC:1]
   AHML_11775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
2615184..2615819
Genome map
AA seq 211 aa AA seqDB search
MITLYGTPVSRALRVSWLLEELDVAWQFQFLDFAKGENRSDWFLTLNPSGKMPVLKDGEF
VLTESAAIMQYLAEVYGPNWLPARGTQASALHAQWVSFITCELEQPLWTIGKHRFALPEA
QRLPAIFPTAKWEFDKAAAIAESWVPEQGYLLGEQVTIADLLLAHTLMWATRFEQTIPPK
LAAYRDRLAKRPALQAVLAKTQAIADAAQAG
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccttatatggcacccccgtcagccgggccctgcgcgtatcctggttactggaa
gagctggacgtggcatggcagttccagtttctcgacttcgccaagggcgagaaccgcagc
gactggtttctgaccctcaacccgagcggcaagatgccggtgctcaaggacggggagttt
gtgctgaccgaatccgctgccatcatgcagtacctggccgaggtatatggcccgaactgg
ctgccagccagagggacccaggcctcggcgctgcacgcccagtgggtcagtttcatcacc
tgcgagctggagcagccgctgtggaccatcggcaagcaccgcttcgccctgcccgaggcc
cagcgtctgccggccatcttccccaccgccaagtgggagttcgacaaggcggcggccatc
gccgaatcctgggtacccgagcagggttacctgctgggtgagcaggtaaccatcgccgat
ctgctgctggcccataccctgatgtgggccacccgcttcgagcagaccattccccccaag
ctggcagcctatcgggatcgtctggccaaacgccccgccctgcaggcggtgctggccaag
acccaggccatcgccgatgccgcccaggccggctga

DBGET integrated database retrieval system