KEGG   Acinetobacter indicus: CTZ23_12500Help
Entry
CTZ23_12500       CDS       T05342                                 

Definition
(GenBank) thiol:disulfide oxidoreductase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
aid  Acinetobacter indicus
Brite
Enzymes [BR:aid01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     CTZ23_12500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_2 GST_N_3 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: AVH15009
LinkDB All DBs
Position
complement(2565575..2566192)
Genome map
AA seq 205 aa AA seqDB search
MIDLYYWGTPNGHKITIALEEMALPYQIFPINILENDQFQPDFLRISPNNKIPAIVDQDG
PNGQPISIFESGAILQYLGRKTGMFYPVDELERVEVEQWLMWQMGGLGPMLGQNHHFSRF
APERIAYATERYVNESKRLYGVLNKQLIGQKYVAGEYSIADMAILPWLLRHEWQQIPLED
YPHVQDYIERLTARPAVQRALAIQV
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgattgatctttattattggggtacgcccaatggtcataaaattacgattgccttagaa
gaaatggcgctgccataccagattttcccgattaatatccttgaaaacgaccagtttcag
ccagattttctgcgcatttctcccaacaataaaattccggctatcgtcgatcaggatgga
ccgaatggccagccgatttcgatttttgaatcgggggcaatcttgcaatatctgggccgt
aaaaccggcatgttctatccggtagatgagctcgagcgggtagaggtggagcagtggctg
atgtggcaaatgggtggcttaggcccgatgctcggtcagaaccatcactttagccgcttt
gcacccgagcgtattgcctatgccaccgagcgttatgtcaatgaaagcaaacgtctgtat
ggcgtgttaaacaagcagctgatcgggcagaaatatgtagccggtgaatattcaattgcc
gatatggcgattttaccgtggttgttacgccatgaatggcagcagattccgctagaagat
tatccgcatgtgcaggattatattgagcgtttaaccgcccgtccggcagtacaacgcgcc
ctggcgattcaggtttaa

DBGET integrated database retrieval system