KEGG   Arachis ipaensis: 107623220Help
Entry
107623220         CDS       T04301                                 

Definition
(RefSeq) superoxide dismutase [Mn], mitochondrial
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
aip  Arachis ipaensis
Pathway
Peroxisome
Brite
KEGG Orthology (KO) [BR:aip00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    107623220
Enzymes [BR:aip01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     107623220
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
B10
AA seq 237 aa AA seqDB search
MAARSLLTRKTLATVLRRDSTALGAQAAAHSRGLHTFTLPDLNYDYGALEPAISGEIMEI
HHKKHHQTYVTNYNKALEQLHDALPKGDASTIVKLQSAIKFNGGGHINHSIFWKNLAPQR
EGGGEPPKGSLGWAIDEHFGSFEKLVQKVNAEGAALQGSGWVWLGLDKEFKKLVVETTAN
QDPLITKGPGLVPLLGIDVWEHAYYLQYKNVRPDYLNNIWKVINWKYASEVYEKESS
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgcgatccctattgacccgaaaaaccctagccacagtgctccgccgtgactcc
acggcactgggcgcacaagcagcagcacattcgcgcggacttcacactttcacgctgccg
gatctgaattacgactacggcgcactggagccggctataagcggggagatcatggagatt
caccacaagaagcaccatcagacttacgtcactaattacaacaaggccctcgagcagctt
cacgatgctctccctaagggcgatgcttctaccatcgttaagctccagagtgccatcaag
ttcaacggcggaggtcatatcaaccactctattttctggaagaatctagctccgcaacgg
gaaggaggcggcgagccacccaagggttcgctgggatgggccattgacgagcattttggc
tctttcgaaaaattggtacagaaggtgaacgcagagggtgctgccttacaagggtctgga
tgggtgtggctcggtctagacaaggagtttaagaagcttgtagttgaaaccactgccaat
caggacccactgattacaaagggaccaggattggttccattgcttggcatagacgtttgg
gagcatgcatattacttacagtacaagaatgtcagaccagactatctgaacaacatttgg
aaagttattaactggaaatatgccagcgaagtgtatgaaaaagagagctcttaa

DBGET integrated database retrieval system