KEGG   Amycolatopsis japonica: AJAP_17045Help
Entry
AJAP_17045        CDS       T03225                                 

Definition
(GenBank) Hypothetical protein
Organism
aja  Amycolatopsis japonica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_primase_S DUF348
Motif
Other DBs
NCBI-ProteinID: AIG76277
UniProt: A0A075UQ29
LinkDB All DBs
Position
3595505..3596443
Genome map
AA seq 312 aa AA seqDB search
MAKSSAVEIEVGDRTVRVSNPDRVYFPARGETKLDLVEYYLAVGDGIVRALRERPCMLHR
FPSGVSGDKVHQKRVPNGAPDWLQTVRVDFPSGRHAYELCVTHPADVIWAVQMSTVEFHP
WNSRRADTERPDEWRIDLDPMPDCPFSTVRKVAGTVREILDELGITGFPKTSGGHGMHVY
VRIEPRWGFQEVRRAALAFAHEVERRMPDEVTTTWWRKDRDPSKLFVDYNQNARDHTIAS
AYSVRGVPEAVVSTPIRWDEVDDVEPRDFTIATVPARFAELGDLHAGIDDTAYSLDTLLE
WADRDGLDTDGE
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaagctcggcggtggagatcgaggtcggcgaccggacggtgcgcgtctcgaac
ccggatcgtgtctatttcccggcgcggggtgagacgaaactcgacctcgtcgagtactac
ctcgcggtcggcgacgggatcgtgcgggcgctgcgggaacggccgtgcatgctgcaccgg
ttcccgtccggggtgtcgggggacaaggtccaccagaaacgggtccccaacggtgccccg
gactggctgcagacggtccgcgtcgacttcccgtccggcaggcacgcctacgagctgtgc
gtcacccatcccgctgacgtgatctgggcggtgcagatgtcgaccgtcgagttccatccg
tggaactcccgccgcgccgacaccgaacgccccgacgagtggcggatcgacctcgacccg
atgcccgactgcccgttctccaccgtgcggaaggtcgccggcaccgtccgcgagatcctg
gacgaactcggcatcaccggcttcccgaagacctccggcgggcacggcatgcacgtctac
gttcggatcgaaccgcgatggggtttccaggaggtgcgccgggcggcgctcgccttcgcg
cacgaggtcgagcggcggatgcctgacgaggtgaccacgacctggtggcgcaaggaccgc
gatccctcgaagctgttcgtggactacaaccagaatgcccgtgaccacaccatcgcgagt
gcgtactcggtccgcggcgtgccggaagccgtcgtctcgaccccgatccgctgggacgag
gtggacgacgtcgagccccgcgacttcacgatcgccaccgtgcccgcgcgtttcgccgaa
ctcggcgacctgcacgcgggcatcgacgacacggcgtactcgctcgacaccctgctcgaa
tgggccgatcgcgacggcctcgataccgacggcgagtga

DBGET integrated database retrieval system