KEGG   Amycolatopsis japonica: AJAP_24045Help
Entry
AJAP_24045        CDS       T03225                                 

Definition
(GenBank) Conserved putative secreted protein
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
aja  Amycolatopsis japonica
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:aja00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    AJAP_24045
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    AJAP_24045
Enzymes [BR:aja01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     AJAP_24045
Bacterial toxins [BR:aja02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   AJAP_24045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
5159122..5160642
Genome map
AA seq 506 aa AA seqDB search
MKISRVAQGLFAALVATAAVGATPATSLATPATGDRISAAAVGNTLVYKQKTEGYDCFRI
PAIVKANNGELLAFAEGRNGGASFCNDSGDIDLVVKRSADNGKTWSAPKIVIEGFGDTKG
NPTPIVIPSTGRIVLLSVMECVKNPDCNRIPRVSISDDHGKTWTAPKVLTTQLGFDTAPG
WLATGPSHGIVLTRGAHAGRIVAGMSYTIDGKNSGALVYSDDQGVTWKRGATDTPATTAG
LNPQEISVTELLDGRVYAAARNQANNDNKCLSGGAKNRAYAISSDGGASFSTKFTFEEDL
ITPVVQASTVRMTATDKAGKYNRILFAAPSVCDRRKELVVRSSFDEGANWQGNSAGTLVW
SGDAAYSDMVQLSSGSVGVLYEAGPAGNANETIRFSTVTETTLGAPVCGGGYGVIDSAPL
GTAGTVYLSYNASNGQNCVSTMKGEAAGTATATSAYLEVSGSARITDSGSFSWFAGPVRA
AAAGKCVKWGGSAGGIKYDSPSEHCG
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
gtgaagatctcccgcgtcgcacagggtctgttcgcggccctcgtcgccaccgcggcggtc
ggcgcaaccccggccacctccctcgccacaccggccaccggcgaccggatttcggccgcc
gccgtcgggaacacgttggtgtacaaacagaaaacagaaggttacgactgcttcagaatc
cccgcgatcgtcaaggcgaacaacggcgagctgctcgcgttcgccgaaggacgcaacggc
ggcgccagcttctgcaacgacagtggcgacatcgatctcgtcgtgaaacgctccgccgac
aacggcaagacctggagcgccccgaagatcgtcatcgaaggtttcggtgacaccaaagga
aacccgaccccgatcgtgatcccgtccaccgggcggatcgtgctgctgtcggtgatggaa
tgcgtcaagaacccggactgcaaccggattccgcgcgtctcgatcagcgacgaccacggc
aagacgtggaccgcgccgaaggtgctcaccacacaactcgggttcgacaccgcgccgggc
tggctcgcgaccggcccgtcgcacggcatcgtgctgacgcgcggcgcgcacgccggccgg
atcgtcgccgggatgagttacaccatcgacggcaagaacagcggcgcgctcgtctacagc
gacgaccagggtgtcacgtggaagcgcggcgccacggacaccccggcgacgacggccggg
ctcaacccgcaggagatcagcgtcaccgaactgctcgacgggcgcgtctacgccgcggcg
cgcaaccaggccaacaacgacaacaaatgcctgagtggcggcgcgaagaaccgtgcctac
gccatcagttccgacggcggggcgagcttctccaccaagttcaccttcgaggaggacttg
atcacgccggtggtgcaggcctcgaccgtgcggatgaccgcgaccgacaaggcgggcaag
tacaaccggatcctgttcgccgcgccgtcggtctgcgaccgccgcaaggaactcgtcgtg
cggtcgtcgttcgacgagggcgcgaactggcagggcaactccgccggaaccctggtgtgg
agcggtgacgccgcgtactccgacatggtccagctttcgtcgggctcggtcggcgtgctg
tacgaggcgggcccggcgggcaacgccaacgagaccatccgcttctcgaccgtcaccgag
acgaccctcggcgccccggtctgcggcggcggatacggcgtgatcgactcggcgccgctc
gggacggccggcacggtttacctgtcctacaacgcttccaacggacagaactgtgtcagc
acgatgaagggtgaagcggcgggcaccgcgaccgcgacgtcggcctatctcgaggtgtcg
gggtcggcccggatcaccgactcgggctcgttctcgtggttcgccggtccggtacgggcg
gccgcggcgggcaaatgcgtgaaatggggcggttccgcgggcgggatcaagtacgacagc
ccgtccgaacactgcggctga

DBGET integrated database retrieval system