KEGG   Acidovorax sp. JS42: Ajs_3073Help
Entry
Ajs_3073          CDS       T00455                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
Organism
ajs  Acidovorax sp. JS42
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3241129..3243090
Genome map
AA seq 653 aa AA seqDB search
MPFDTLHAILPATARDDRQITLIEGDKEQRVLSFQRLRQRALAVLGALQRQSIAPGDTMI
LCLADNERFLEMFWACVLGGIVPVPLAPGATDAHRQKLLRVFAQLGPKASVYIDRTSLER
LDGFAAAQGLADQAAALRARALVPGGLDIGGEPGQPVSPRPDDLAFIQYSSGSTGEPKGV
LLTHRNLCANIAAIIEAAAFSDRDVALSWMPLSHDMGLIGFHLNMLACGASHAIMRTDLF
ARRPLLWLDQASQRRATVLCSPNFGYQHYLRQFALKPPQGLDLSAVRLIFNGAEPISADL
CRRFTQAMAPHGLQPNAMFPVYGLAEASLAVSFPPPSTPLETIELDRTALRVGAPVRAAA
PGSTHAIEFVKLGRAVPGCEIRIVDDAGTGLADRTVGHVQIRGDNVSGGYFRDRSGNGAS
RVTPGWLDTGDLGVMLDGQLVITGRAKDLIIVNGQNYYPTDLEEIAQQVPGIEANRVAAV
GVRDASEGTESVALFVIHRGDLAGFVPKVQALRRIIGQQTDLELNHIVPVSAIPKTTSGK
LQRYALALAFEQGEFATIRSELAGFMSANAAIEPVEAGPKSTALRLKEICEPLIPDQQIT
VQTNLLEINLKSLTLARIHEAIEREFPQRIEVTDLFEYPTLEQLAKLLDETQT
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgccattcgacaccctccacgccatcctgcccgccaccgcgcgcgacgaccgccagatc
acgctcatcgagggcgacaaggagcagcgcgtgctgagcttccagcggctgcgccagcgc
gcgctcgccgtgctcggcgcgctccagcgccagtcgatcgcgcccggcgacacgatgatc
ctgtgcctggccgacaacgagcgcttcctggaaatgttctgggcctgcgtgctgggcggc
atcgtgccggtgccgctcgcgcccggcgccaccgatgcgcaccgccagaagctgctgcgt
gtgttcgcgcagctcggcccgaaggcgtcggtctacatcgaccgcacgtcgctggaacgc
ctcgacggcttcgccgcggcacaagggctggccgaccaggcggcggcgctgcgtgcccgc
gccctggttccgggcggcctcgacatcggcggcgaaccgggacagcccgtgtcgccgcgt
ccggacgacctggcgttcatccagtattcctccggctccaccggcgagcccaagggcgtg
ctgctaacgcaccgcaacctgtgcgccaacatcgccgcgatcatcgaggccgcggccttc
tccgaccgcgacgtggcgctcagctggatgccgctgtcccacgacatggggctgatcggc
ttccacctgaacatgctggcctgcggcgccagccacgcgatcatgcgcaccgacctgttc
gcgcggcgccccctgctctggctcgaccaggccagccagcgccgggccacggtgctgtgc
tcgccgaacttcggctaccagcattacctgcggcagttcgcgctgaagccgccccagggg
ctggacctgtcggccgtgcgactgatcttcaatggcgccgaaccgatctcggccgatttg
tgccggcgtttcacccaggccatggcgccccatggactccagccgaatgccatgtttccg
gtgtacgggttggccgaagccagcctggcggtgagcttcccgcccccatcgacaccgcta
gagacgatcgagctcgaccggacagcccttcgtgtcggcgcgcccgtgcgcgctgcggca
cctgggtcgacgcatgccatcgaattcgtcaagctcggccgcgccgtgcccggatgcgag
atccggatcgtggacgacgccggcaccggcttggccgaccggacggtcggccatgttcag
atccggggcgacaacgtgtccggtggctattttcgggacaggagcggcaacggtgcctcg
cgggtgacacccggatggctggacaccggcgacctgggcgtgatgctggacgggcagctc
gtgatcacgggtcgggccaaggacctgatcatcgtcaacggacagaactactacccgacc
gatctggaggagatcgcccaacaggtgcccggtatcgaggccaaccgggtggcagcggtc
ggggtgcgcgacgccagcgaaggcaccgaatcggtcgcgctgttcgtgatccaccgcggg
gatctggcgggcttcgtgccgaaagttcaggctttgcgacgcatcatcggccagcaaacc
gacctggaactgaaccacatcgtgcctgtcagcgccattccgaagaccaccagtggcaag
ctgcaacggtatgctttggccctcgccttcgaacaaggcgaattcgctacaatacgctcg
gaattggcagggtttatgtcagcgaacgccgcgatcgaacctgtcgaggcagggccgaaa
tcaacggctctgcgcctcaaggagatctgcgagccattgattccagaccagcagatcacg
gtccaaaccaacttgctggaaatcaacctcaaatcgctcactctggcgcgcatccatgaa
gcgatcgagcgcgaattcccccagcggatcgaggtcacggatcttttcgaatacccgacg
ctggagcagctggcgaaacttctggacgaaacccagacttga

DBGET integrated database retrieval system