Acinonyx jubatus (cheetah): 106989164 Help Entry 106989164         CDS       T04657                                  Name (RefSeq) C-X-C motif chemokine 14   KO K10033   C-X-C motif chemokine 14 Organism aju  Acinonyx jubatus (cheetah) Pathway aju04060   Cytokine-cytokine receptor interaction aju04061   Viral protein interaction with cytokine and cytokine receptor aju04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:aju00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     106989164    04061 Viral protein interaction with cytokine and cytokine receptor     106989164  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     106989164  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:aju04052]     106989164 Cytokines and neuropeptides [BR:aju04052]  Cytokines   Chemokines    106989164 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 DUF6355 NinB Motif Other DBs NCBI-GeneID:  106989164 NCBI-ProteinID:  XP_014943122 UniProt:  A0A6J0AB33 LinkDB All DBs Position A1:complement(110892892..110901016) Genome browser AA seq 99 aa AA seqDB search MRLLSAALLLLLLALCAARVDGSKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITT KSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgaggctcctgtccgccgcgctactcctgctgctcctggcgctgtgcgccgcacgcgtg gacgggtccaaatgtaaatgctcccgaaaggggcccaagattcgatacagcgacgtgaag aagctggaaatgaagccaaagtacccgcactgcgaggagaagatggttatcatcaccacc aagagcgtgtccaggtaccggggtcaggagcactgcctgcaccccaagctgcagagcacc aagcggttcatcaagtggtacaacgcctggaacgagaaacgcagggtctacgaagagtag

DBGET integrated database retrieval system