KEGG   Advenella kashmirensis: TKWG_24890Help
Entry
TKWG_24890        CDS       T02117                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
aka  Advenella kashmirensis
Pathway
aka00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:aka00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    TKWG_24890
Enzymes [BR:aka01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     TKWG_24890
Transporters [BR:aka02000]
 Other Transporters
  Pores ion channels [TC:1]
   TKWG_24890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: AFK64525
UniProt: I3UHN7
LinkDB All DBs
Position
4274113..4274745
Genome map
AA seq 210 aa AA seqDB search
MSASRITFYSNPQSRAAVIHWMLEELGEPYDTVYLNYQGAMKTPEYLAINPMGKVPAIMH
DGQVVTEGAAICAFLADQYPQKNLAPAIDSPSRGAYYRWLFFAAGPLEEAITMKSLGMPI
PADKSAMLGFGTLERTVDVLEQAVSSTTWICGEQFTAADVYVGSAIRFYMQFGALEPRPA
FKAYVDRITQRPAYQRSAKIMEQAMAKSQQ
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgtcagccagccgcattaccttttactccaacccacagtcccgcgctgcggttatccac
tggatgctggaagagttgggcgaaccgtacgataccgtctatctgaactatcagggagcc
atgaaaacacccgagtatctggccatcaatccgatgggcaaggttccggccatcatgcat
gacggccaggtggttaccgaaggcgcggccatctgcgcatttctggcggatcagtacccg
cagaaaaacctggcgcccgcgatcgacagcccctcacgcggcgcttattatcgctggctg
ttctttgcggccgggccgctggaggaagcgatcaccatgaaatccctgggtatgcccatt
ccggcggacaaaagcgcgatgctgggttttggcacactggagcgcacggtcgatgtgctg
gagcaggctgtgtccagcaccacctggatttgcggcgagcagttcactgctgccgatgtg
tacgtgggttcggcaatccggttttatatgcagttcggtgcacttgaaccacgccctgca
tttaaggcctacgtggaccgcatcacgcaacggcctgcctatcagcgcagcgccaaaata
atggaacaggccatggccaaatcgcagcagtaa

DBGET integrated database retrieval system