KEGG   Acinetobacter larvae: BFG52_12905Help
Entry
BFG52_12905       CDS       T04708                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
ala  Acinetobacter larvae
Brite
Enzymes [BR:ala01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     BFG52_12905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_2 GST_N_3 GST_C GST_C_3 GST_C_2 Glutaredoxin2_C
Motif
Other DBs
NCBI-ProteinID: AOA59161
UniProt: A0A1B2M1Y0
LinkDB All DBs
Position
complement(2896503..2897120)
Genome map
AA seq 205 aa AA seqDB search
MIDLYYWGTPNGRKISIALEEMKLPYQIIPINIGENDQFQADFLKISPNNKIPAIVDQDG
PQGQAISVFESGAILQYLGRKTGQFYPQDELQRVQVEQWLMWQMGGLGPMLGQNHHFNRF
APVQIDYAQQRYINESKRLYKVLEQQLIGQDYVCGAYSIADMAIFPWLLSYAWQSIDLAD
YPNVAAYIARIQARPAVQRALAIEL
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgattgatttatattattggggaaccccaaatggtcgtaaaattagtattgcattagaa
gaaatgaaactgccttatcaaattattccgattaatattggtgagaatgatcaattccaa
gcagattttttaaaaatctcgcctaataataaaattccagcaattgtcgatcaggatgga
ccacaaggacaagccatttcagtatttgaatccggcgcgattttacaatatctaggacga
aaaacagggcagttttatccgcaagatgaattacagcgtgtgcaagttgagcaatggttg
atgtggcaaatgggaggcttaggaccaatgcttgggcaaaaccaccattttaatcgtttt
gcaccagtacaaattgactatgcgcaacagcgttatatcaatgaatcaaaaagattatat
aaggttttagagcagcagttaattggtcaagactatgtctgcggtgcatactcgattgcc
gatatggctattttcccttggctgttgtcttatgcatggcaaagtatcgatctggcggat
tatcccaatgtggcggcttatattgcgcgtatacaagctcgacctgccgtgcaacgtgct
ttagcaatagagctttag

DBGET integrated database retrieval system