KEGG   Alteromonas naphthalenivorans: ambt_09930Help
Entry
ambt_09930        CDS       T01513                                 

Definition
(GenBank) zinc-dependent metallopeptidase
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
alt  Alteromonas naphthalenivorans
Brite
Enzymes [BR:alt01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     ambt_09930
Peptidases [BR:alt01002]
 Metallo Peptidases
  Family M2
   ambt_09930
Exosome [BR:alt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ambt_09930
CD molecules [BR:alt04090]
 Proteins
  ambt_09930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-ProteinID: AEF03512
UniProt: F5Z8W9
LinkDB All DBs
Position
2214090..2215913
Genome map
AA seq 607 aa AA seqDB search
MFSTKRTIVAALVSITLIGCGEATTKTETTPAAPTAQDAQEFLINAQNDISKMQVPAAHA
EWSYATNINFDTAAVSAYFNEVLSTKVAVLAKEAAKFNDVEVDEDTRRQLNLLKNGLTMP
PPSDPAKAEQLAKIGSELSAMYGSGQYCMEDGTCKSLVEMSSEMATIRDADTLLEYWKGW
REVSVPMKPLYEQQVNLANEGAAELGFQNVSELWRGKYDMPADDFPKELDRLWGQVAPFY
ESLHCHVRAKLGEHYGEELVPQDQPIPAHLLGNMWAQTWGNVYDIVKPEQEMSVPDVTSS
LVAQGYDEIKMVKQAESFFSSLGFAPLPDTFWERSMFQKPEGRDVQCHASAWDLDDKDDL
RIKMCIQKTGEEFNVIHHELGHNYYQRAYKDQPLLYRGSANDGFHEAIGDTIALSITPKY
LKEIGLIDEIPDASNDIGMLMQVALDKIAFIPFGLMVDQWRWKVMAGEVSPEQYNTLWWE
LREKYQGVKAPIDRPADAFDPGAKYHVPANVPYTRYFLAHILQFQFHKALCDIAGDEGPL
NRCSIYNSEEAGTALNAMLEMGMSQPWQNALETLTGSPEMDASTIADYFAPLKTWLDEQN
ATRQCGW
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgttttcaactaaacgcactatcgtcgcagcactcgttagcattacgctaataggttgc
ggtgaagctactaccaaaactgaaaccacacctgcggcccctaccgcgcaagatgcgcaa
gaattccttattaatgcgcaaaacgacattagtaaaatgcaggtgccagccgcacatgcc
gagtggagttacgccactaacatcaattttgataccgccgcggtaagtgcctattttaat
gaagtgctgtctaccaaagtagcggtattagctaaagaagcggctaaatttaacgatgtt
gaagtagatgaagatacccgtcgtcaactcaatttgctcaaaaacgggcttaccatgcca
cctccgtcagatccggcgaaagcagagcaacttgctaaaattggttctgagcttagtgca
atgtatggttctggccagtactgcatggaagatggcacctgtaaaagcttggtagaaatg
agtagtgaaatggcgactattcgcgatgccgacaccttactagagtactggaaaggttgg
cgtgaagtgtcagtacctatgaagccgctttatgaacaacaggtcaatttggccaacgaa
ggcgctgctgaattaggctttcaaaacgttagcgaactatggcgcggtaaatacgatatg
ccagccgacgattttccgaaagagcttgatagattgtgggggcaagttgcgcctttctat
gaatcgttacactgtcacgttcgtgctaagttaggtgagcattatggtgaagaattggtt
ccgcaagaccaacctattccagcgcacttgttaggcaatatgtgggcgcaaacctggggc
aatgtttacgatatcgtgaaacctgaacaagaaatgtcagtacccgacgttacctcatca
cttgttgcgcagggctatgatgaaataaagatggtgaaacaggctgaatctttcttttct
tcactgggctttgcgccgctgcctgatacgttttgggaacgttctatgttccaaaaacct
gaaggtcgggacgtacagtgtcacgcttcagcatgggacctagacgataaagacgatttg
cgtattaagatgtgtatccaaaaaacgggggaagagttcaacgttattcatcatgaactg
ggtcacaactattatcagcgcgcttacaaagaccagcctttgctgtatcgcggttcagct
aacgatggcttccatgaagcgattggcgacaccattgccttgtcgattacccctaagtac
cttaaagaaattggtttgattgacgagattccagatgcatctaacgacataggcatgcta
atgcaggtagcgctagataaaattgcctttattccatttggtttgatggtcgatcaatgg
cgctggaaagtaatggctggtgaagtttcacctgagcaatacaatacactttggtgggaa
ttaagagaaaaataccaaggcgtaaaagcaccgatagacagacctgctgatgcgtttgac
ccaggcgctaaatatcatgttcctgctaacgtgccctacacgcgctatttcttagcacat
attttgcaatttcaattccataaagcgttatgtgatattgcaggtgatgaaggtccactt
aatcgctgctctatttacaacagtgaagaagcgggtacagcactaaacgccatgcttgaa
atgggcatgagccagccatggcaaaatgcgttagaaacccttactggttcacctgaaatg
gatgcaagtaccattgctgactactttgcacccttaaaaacctggttagatgagcaaaat
gctacccgtcagtgtggctggtaa

DBGET integrated database retrieval system